DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG30283

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:283 Identity:68/283 - (24%)
Similarity:110/283 - (38%) Gaps:80/283 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PCG----------GRHDLWYYLRPLGYKQQEAKFGEFPWLVAVYGSDTYLCSGALITPLAVITTA 140
            |||          |.|:              |.....||:..|.|...:.|.|.|||...|:|:|
  Fly    32 PCGTVPISQFKILGGHN--------------APVASAPWMAMVMGEGGFHCGGTLITNRFVLTSA 82

  Fly   141 HCVQNSEMEKVRLLAGEWDAAVELEPQPHQQRSVVETL-VHPNY--TQMPLAHNIAILLVDKEKP 202
            ||:.|.|: ||||..        ||.:...|:..|:.: ||.:|  .|    |::|:|.:.|...
  Fly    83 HCIANGEL-KVRLGV--------LEREAEAQKFAVDAMFVHTDYYFDQ----HDLALLRLAKRVH 134

  Fly   203 FQLAPNVQPICLPPPRIMYNYSQCYVS----GWQRSDFGRAAILPKRWTLYVLPPDQCRTKLRLS 263
            :  :.|:.||||....::.|..:..|.    ||.:::...::.:.::.:|:.|...:|..:....
  Fly   135 Y--SDNISPICLLLDPLVKNIDEHIVKFRTYGWGKTESRSSSRMLQKTSLFNLHRSECAKQYPHQ 197

  Fly   264 LLGRRHAHNDSLLCA--------GGDKGDFVCGDVDMTAVPLMCPLS----GHDDRFHLAGLLTR 316
            .:.|.|      :||        .||.|..:...|....|.::....    ||.|          
  Fly   198 QINRNH------ICAESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHAD---------- 246

  Fly   317 TARCDGPQLLGIYTNVKLYRQWI 339
               |....   ::|||..:..||
  Fly   247 ---CSKAT---VFTNVMTHLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 63/254 (25%)
Tryp_SPc 105..339 CDD:214473 61/252 (24%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 63/271 (23%)
Tryp_SPc 43..266 CDD:238113 65/272 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.