DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and Jon44E

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:248 Identity:62/248 - (25%)
Similarity:105/248 - (42%) Gaps:37/248 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 GYKQQEAKFGEFPWLVAV-YGSDTYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVEL 164
            ||...|   |:.|::|.: :....|.|.|::|....|:|.|||..::  ..|.:..|   |:...
  Fly    44 GYPAYE---GKIPYIVGLSFNDGGYWCGGSIIDHTWVLTAAHCTNSA--NHVLIYFG---ASFRH 100

  Fly   165 EPQPHQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLPPPRIMYN-YSQCY- 227
            |.|.....|..:.:.||::... |.::||::.:.....:.|...|:   ||.....|| ||..: 
  Fly   101 EAQYTHWVSRSDMIQHPDWNDF-LNNDIALIRIPHVDFWSLVNKVE---LPSYNDRYNSYSGWWA 161

  Fly   228 -VSGWQRSD--FGRAAILPKRWTLYVLPPDQCRTKLRLSLLGRRHAHNDSLLCAGGDKGDFVC-G 288
             .|||..:|  .|.:..| ....:.::..:.||     :..|..:. .|:.:|...|.|...| |
  Fly   162 VASGWGLTDNNSGMSNYL-NCVDVQIIDNNDCR-----NYYGSNYI-TDNTICINTDGGKSSCSG 219

  Fly   289 DVDMTAVPLMCPLSGHDDRFHLAGLLT--RTARCDGPQLLGIYTNVKLYRQWI 339
            |   :..||:.    ||:. .:.|:::  ....|...:..| :|.|..|..||
  Fly   220 D---SGGPLVL----HDNN-RIVGIVSFGSGEGCTAGRPAG-FTRVTGYLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 60/244 (25%)
Tryp_SPc 105..339 CDD:214473 58/242 (24%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 60/246 (24%)
Tryp_SPc 41..266 CDD:238113 62/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435349
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.