DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and try-9

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:249 Identity:52/249 - (20%)
Similarity:86/249 - (34%) Gaps:63/249 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 SGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVELEPQPHQQRSVVETLVHPNYTQ------ 185
            :|.|::|..::|.||.:..||........|....|..:....:....|..|...|...:      
 Worm    29 TGTLVSPWHIVTAAHLIGISEDPLPDCDTGNLREAYFVRDYKNFVAFVNVTCAVPEMCKGLHRKD 93

  Fly   186 --MPLA---------------------HNIAILLVDKEKPFQLAPNVQPICLPP----PRIMYNY 223
              .|||                     ::||:.  :.|:|.:.:.::.|.|||.    |||.   
 Worm    94 MFKPLAIKSLYIRKGYVGDGCIDRESFNDIAVF--ELEEPIEFSKDIFPACLPSAPKIPRIR--- 153

  Fly   224 SQCYVSGWQRSDFGR---AAILP--KRWTLYVLPPDQCRTKLRLSLLGRRHAHNDSLLCAGGDKG 283
                .:|::...:||   .::|.  |..:||.... :|........:....|.|..|.| .||.|
 Worm   154 ----ETGYKLFGYGRDPSDSVLESGKLKSLYSFVA-ECSDDFPYGGVYCTSAVNRGLSC-DGDSG 212

  Fly   284 DFVCGDVDMTAVPLMCPLSGHDDRFHLAGLLTRTARCDGPQLLGIYTNVKLYRQ 337
            ..|....|...|.:            |.|:|:....|  |:|...:...:..|:
 Worm   213 SGVVRTSDTRNVQV------------LVGVLSAGMPC--PELYDTHNRQRQQRR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 52/249 (21%)
Tryp_SPc 105..339 CDD:214473 52/249 (21%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 48/229 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.