DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and Jon25Bi

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:265 Identity:55/265 - (20%)
Similarity:88/265 - (33%) Gaps:73/265 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 GYKQQEAKFGEFPWLVAV--YGSDTYLCSGALITPLAVITTAHCVQNSEMEKVRLLAG-EWDAAV 162
            ||...|   |:.|:.|.:  .|:..:.|.|::|....|:|.|||...:  .:|.:..| .|....
  Fly    40 GYPAYE---GKAPYTVGLGFSGNGGWWCGGSIIAHDWVLTAAHCTNGA--SQVTIYYGATWRTNA 99

  Fly   163 ELEPQPHQQRS--VVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLPPPRIMYNYSQ 225
            :.   .|...|  .::....||..    .::||::.......:.:...|:   ||.....||...
  Fly   100 QF---THTVGSGDFIQNHNWPNQN----GNDIALIRTPHVDFWHMVNKVE---LPSFNDRYNMYD 154

  Fly   226 CY---VSGWQRSDFGRAAILPKRWTLYVLPPDQC-RTKLRLSLLGRRHAHNDSLLCAGGDKGDFV 286
            .|   ..||..:..|......:...|.::...:| ||         .....|.:||.....|...
  Fly   155 NYWAVACGWGLTTAGSQPDWMECVDLQIISNSECSRT---------YGTQPDGILCVSTSGGKST 210

  Fly   287 C-GDVDMTAVPLMCPLSGHDDRFHLAGLLTRTARCDGPQLLGI----------------YTNVKL 334
            | ||   :..||:         .|           ||.:|:|:                :|.|..
  Fly   211 CSGD---SGGPLV---------LH-----------DGGRLVGVTSWVSGNGCTAGLPSGFTRVTN 252

  Fly   335 YRQWI 339
            ...||
  Fly   253 QLDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 53/261 (20%)
Tryp_SPc 105..339 CDD:214473 51/259 (20%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 53/263 (20%)
Tryp_SPc 37..260 CDD:238113 55/265 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435357
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.