DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and Jon25Bii

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster


Alignment Length:260 Identity:59/260 - (22%)
Similarity:96/260 - (36%) Gaps:58/260 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 GYKQQEAKFGEFPWLVAV-YGSDT--YLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAV 162
            ||...|   |:.|::|.: :.||:  :.|.|::|....|||.|||...:  ..|.:..|   |..
  Fly    46 GYPAYE---GKVPYIVGLGFSSDSGGWWCGGSIIGHTWVITAAHCTHGA--HSVTIYYG---ALW 102

  Fly   163 ELEPQPHQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLPPPRIMYNYSQ-- 225
            .|:.|............|.:|....|.::|:::.......:.|...|:   ||.....::...  
  Fly   103 RLQAQYTHTVGSGHFRQHSDYNTNNLNNDISLINTPHVDFWHLINKVE---LPDGNERHDSFAGW 164

  Fly   226 -CYVSGWQR-------SDFGRAAILPKRWTLYVLPPDQCRTKLRLSLLGRRHAHNDSLLCAGGDK 282
             ...|||.|       ||:....      ...::..|:|.:.....::      .|:::|.....
  Fly   165 WALASGWGRPCDSCGVSDYLNCV------DSQIITRDECSSVYGTDVI------TDNVICTSTPG 217

  Fly   283 GDFVC-GDVDMTAVPLMCPLSGHDDRFHLAGLLTRTAR--C-----DGPQLLGIYTNVKLYRQWI 339
            |...| ||   :..||:.     .||..|.|:.:..|.  |     ||      :|.|..|..||
  Fly   218 GKSTCAGD---SGGPLVL-----HDRSKLVGVTSFVAASGCTSGLPDG------FTRVTSYLDWI 268

  Fly   340  339
              Fly   269  268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 57/256 (22%)
Tryp_SPc 105..339 CDD:214473 55/254 (22%)
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 57/258 (22%)
Tryp_SPc 43..271 CDD:238113 59/260 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435350
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.