DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and sphe

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:249 Identity:50/249 - (20%)
Similarity:96/249 - (38%) Gaps:36/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 RPLGYKQQEAKFGEFPWLVAVYGSDTYLCSGALITPLAVITTAHCVQNS----EMEKVRLLAGEW 158
            |.:|.:..:|....|...:.|  .:.::|.|::::...::||||||...    :..::....|..
  Fly    25 RIMGGEDADATATTFTASLRV--DNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGST 87

  Fly   159 D--AAVELEPQPHQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLPPPRIMY 221
            :  |..::.       :|....|||:|..  |.:|:|::.:..|..:.......|:......:..
  Fly    88 NQYAGGKIV-------NVESVAVHPDYYN--LNNNLAVITLSSELTYTDRITAIPLVASGEALPA 143

  Fly   222 NYSQCYVSGWQRSDFGRAAILPKRWTLYVLPPDQCRTKLRLSLLGRRHAHNDSLLCAGGDKGDFV 286
            ..|:..|:||.|:..|..:...::.:|.|.|...|        |.....|::...|...:..:..
  Fly   144 EGSEVIVAGWGRTSDGTNSYKIRQISLKVAPEATC--------LDAYSDHDEQSFCLAHELKEGT 200

  Fly   287 C-GDVDMTAVPLMCPLSGHDDRFHLAGLLTRTARCDGPQLLGIYTNVKLYRQWI 339
            | ||....|:      .|:.    |.||........|.:...::..:..|..||
  Fly   201 CHGDGGGGAI------YGNT----LIGLTNFVVGACGSRYPDVFVRLSSYADWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 48/242 (20%)
Tryp_SPc 105..339 CDD:214473 46/240 (19%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 46/232 (20%)
Tryp_SPc 42..244 CDD:214473 44/230 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435375
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.