DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG31220

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:373 Identity:87/373 - (23%)
Similarity:132/373 - (35%) Gaps:86/373 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KVCGPEKHCVPYEQCNEGLMVDGKFYPDRSRTTLD----ENCHYMEKC-CNIPDK-------LPT 75
            |:|.|::.|:..:.|.       ..|.:..|..|.    .|......| .::.|:       :..
  Fly    25 KLCEPDEECIRLKDCR-------PIYYNVRRNRLSGSAKVNISQTRMCGVSVRDRKRYKRIYICC 82

  Fly    76 PKIPEEMMSCP-CGGRHDLWYYLRPLGYKQQ---------EAKFGEFPWLV-------AVYGSDT 123
            ||....:.|.| ||              |.|         |....|:|||.       :.:..|.
  Fly    83 PKPANTLPSYPDCG--------------KPQTTNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDR 133

  Fly   124 YL---CSGALITPLAVITTAHCVQNSEMEKVRLLAGEW-----------DAAVELEPQPHQQRSV 174
            .|   |.|:||....|:|.||||.::.::..|:..||.           .|.:...| .|....|
  Fly   134 ELVPSCGGSLINTRYVLTAAHCVTDTVLQIQRVRLGEHTTSHNPDCISRGARIVCAP-THLDIDV 197

  Fly   175 VETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPIC-LPPPRIMYNYSQCYVSGWQRSD-FG 237
            .....|.:|..........|.||..::|.:......||| |..||.:..: :.||:||.::. |.
  Fly   198 ESITSHNDYDPANYTFRNDIALVRLKEPVRYTMAYYPICVLDYPRSLMKF-KMYVAGWGKTGMFD 261

  Fly   238 RAAILPKRWTLYVLPPDQCRTKLRLSLLGRRHAHNDSLLCAGGDKGDFVC-GDVDMTAVPLMCPL 301
            ..:.:.|...:.|..|::|..|     ...||......:||||......| ||..       .||
  Fly   262 TGSKVLKHAAVKVRKPEECSEK-----YAHRHFGPRFQICAGGLDNRGTCDGDSG-------SPL 314

  Fly   302 SGHDDRFH-----LAGLLTRTARCDGPQLLGIYTNVKLYRQWIDLKLR 344
            .|...|.:     |||:.:....|.......::|....:.:||...||
  Fly   315 MGTSGRSYETITFLAGITSYGGPCGTIGWPSVFTRTAKFYKWIRAHLR 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 66/272 (24%)
Tryp_SPc 105..339 CDD:214473 65/271 (24%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 64/267 (24%)
Tryp_SPc 104..360 CDD:238113 66/269 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435452
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.