DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG8952

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:243 Identity:55/243 - (22%)
Similarity:94/243 - (38%) Gaps:59/243 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 EAKFGEFPWLVAVYGS--DTYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVELEPQP 168
            :||.|:|||.|.:...  |..||.|::|:...|:|.|||...  :..:.|:.|    .|:|....
  Fly    43 DAKLGQFPWQVILKRDAWDDLLCGGSIISDTWVLTAAHCTNG--LSSIFLMFG----TVDLFNAN 101

  Fly   169 HQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLP---PPRIMYNYSQCYVSG 230
            ....:....::||:|..   ..|..:.|:...:|...:.|:|.|.|.   ...|.|..|...::|
  Fly   102 ALNMTSNNIIIHPDYND---KLNNDVSLIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATIAG 163

  Fly   231 W-----QRSDFGRAAILPKRWTLYVLPPDQCRTKLRLSLLGRRHAHNDSLLCAGGDKGDFVCGDV 290
            :     :..|:....:..:   :.::....|     :::.| ::...||.:||.|..|.      
  Fly   164 FGYTEDEYLDYSETLLYAQ---VEIIDNADC-----VAIYG-KYVVVDSTMCAKGFDGS------ 213

  Fly   291 DMTAVPLMCPLSGHDDRFHLAGLLTRTARCDGPQLLGIYTNVKLYRQW 338
            ||:                     |.|....||.:|  |.  |..:||
  Fly   214 DMS---------------------TCTGDSGGPLIL--YN--KTIQQW 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 55/243 (23%)
Tryp_SPc 105..339 CDD:214473 55/243 (23%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 55/243 (23%)
Tryp_SPc 38..271 CDD:238113 55/243 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435374
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.