DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG31827

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_723923.1 Gene:CG31827 / 318965 FlyBaseID:FBgn0051827 Length:294 Species:Drosophila melanogaster


Alignment Length:276 Identity:83/276 - (30%)
Similarity:142/276 - (51%) Gaps:23/276 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 EEMMSCPCGGRHDLWYYLRPLGYKQQ------EAKFGEFPWLVAVYGSDTYLCSGALITPLAVIT 138
            :::....||       |..|...|.|      :||..||||.:||..:.:.:..|:||||..|:|
  Fly    24 QQIEELKCG-------YGNPDAVKVQFNVTEGQAKPAEFPWTIAVIHNRSLVGGGSLITPDIVLT 81

  Fly   139 TAHCVQNSEMEKVRLLAGEWDAAVELEPQPHQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPF 203
            .||.:.|.::|.:.:.||||:....||..|.::..|::.::|.::.....|:|:|:|.:|:|  |
  Fly    82 AAHRIFNKDVEDIVVSAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDRE--F 144

  Fly   204 QLAPNVQPICLPPPRIMYNYSQCYVSGW---QRSDFGRAAILPKRWTLYVLPPDQCRTKLRLSLL 265
            .|...:..||||..:...:.::|.|:||   |.||.....:| |:..|.::|...|:.:||.:.|
  Fly   145 PLTYKINTICLPTQKRSLSSTRCIVAGWGKYQFSDTHYGGVL-KKIDLPIVPRHICQDQLRKTRL 208

  Fly   266 GRRHAHNDSLLCAGGDKGDFVC-GDVDMTAVPLMCPLSGHDDRFHLAGLLTRTARCDGPQLLGIY 329
            |:.:.....|:||||:|.:..| ||   ....|.||::....:|...|::.....|....:...|
  Fly   209 GQNYTLPRGLICAGGEKDNDACTGD---GGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATY 270

  Fly   330 TNVKLYRQWIDLKLRE 345
            |:|..::.||..:::|
  Fly   271 TDVFEFKPWIVQQIKE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 76/244 (31%)
Tryp_SPc 105..339 CDD:214473 75/243 (31%)
CG31827NP_723923.1 Tryp_SPc 50..283 CDD:238113 76/238 (32%)
Tryp_SPc 50..280 CDD:214473 74/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.