DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG11664

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:245 Identity:59/245 - (24%)
Similarity:108/245 - (44%) Gaps:39/245 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 GYKQQEAKFGEFPWLVAVYGSDTYLCSGALITPLAVITTAHCV-QNSEMEKVRLLAG-EWDAAVE 163
            |...|:..:|   :::.:||.. :|.:|:|.:...|:|.|||. :|::.|::.:.|| .|.|   
  Fly    26 GIPVQQQNYG---YVMQIYGPQ-FLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIA--- 83

  Fly   164 LEPQPHQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLPP--PRIMYNYSQC 226
               ...:.:.|...|.||.::.:.|.::||:|.|..........|...:|..|  |..|:...| 
  Fly    84 ---WEFRGKQVAGLLRHPKFSPLTLRNDIAVLRVKAAISHSHMINYIGLCSRPLTPLNMFAPPQ- 144

  Fly   227 YVSGWQRSDFGRAAILPKRWTLYVLPPDQCRTKL-RLSLLGRRHAHNDSLLCAGGDKGDFVC-GD 289
            .::||......:..   |..::.|.|...||... ::|         ..::||....|:.:| ||
  Fly   145 ELAGWNLMHIAQPL---KSMSVQVEPEKNCRQWFPQIS---------GGVICASATMGEGLCYGD 197

  Fly   290 VDMTAVPLMCPLSGHDDRFHLAGLLTRTARCDGPQLLGIYTNVKLYRQWI 339
               :..||   :||.:    :.||.....:|...:...::|:|..:|.:|
  Fly   198 ---SGDPL---ISGGE----VCGLAIAFRKCGDKRYPALFTDVHYHRAFI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 58/241 (24%)
Tryp_SPc 105..339 CDD:214473 57/239 (24%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 56/230 (24%)
Tryp_SPc 38..237 CDD:214473 55/228 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.