DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG18420

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:270 Identity:64/270 - (23%)
Similarity:110/270 - (40%) Gaps:41/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 EMMSCPCGGRHDLWYYLRPLGYKQQEAKFGEFPWLVAVY-GSDTYLCSGALITPLAVITTAHCVQ 144
            :.:...||.|..|  .|.|.....:.|.....||:..:: .|:.::|.|.||:...|:|.|||..
  Fly    25 QFLDSECGTRSPL--KLGPRIVNGKVAVRNSSPWMAFLHTSSNQFICGGTLISRRLVLTAAHCFI 87

  Fly   145 NSEMEKVRLLAGEWDAAVELEPQPHQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNV 209
            .:....|||  ||::..::...:.||   |..|..|..|.....|::||:|.:.....::  .|:
  Fly    88 PNTTIVVRL--GEYNRKLKGYREEHQ---VNRTFQHRFYDPNTHANDIALLRLVSNVVYK--ANI 145

  Fly   210 QPICLPPPRIMYNYSQCY---------VSGWQRSDFGRAAILPKRWTLYVLPPDQCRTKLRLSLL 265
            :|||     ||::.|..:         .:||.|::....:...:...:...|...|.....||  
  Fly   146 RPIC-----IMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRTLDISRQPSKMCAFGSVLS-- 203

  Fly   266 GRRHAHNDSLLCAGGDKGDFVCGDVDMTAVPLMCPLSGHDD-RFHLAGLLTRTARCDGPQLLGIY 329
                    :..|||....:...||   |..|:...:...:. ||...|:.....||..|   .::
  Fly   204 --------NQFCAGNWNSNLCIGD---TGGPVGAMVRYRNAFRFVQVGIAITNKRCQRP---SVF 254

  Fly   330 TNVKLYRQWI 339
            |:|..:.::|
  Fly   255 TDVMSHIEFI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 58/246 (24%)
Tryp_SPc 105..339 CDD:214473 57/244 (23%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 57/249 (23%)
Tryp_SPc 43..267 CDD:238113 58/250 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435468
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.