DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG30323

DIOPT Version :10

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:260 Identity:59/260 - (22%)
Similarity:92/260 - (35%) Gaps:77/260 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 DTYLCSGALITPLAVITTAHCV---------QNSEMEKVRLLAGEWDAAVELEPQP----HQQRS 173
            |.:.|:|:|::...|:|:..||         |.|..:.:|::.  :......:|.|    |.|:.
  Fly    50 DNHFCAGSLLSAWWVVTSGCCVSTRPESTPNQPSNRKNLRVVV--FTPKRLKKPSPKNIYHVQKI 112

  Fly   174 VVETLVHPNYTQMPL--------AHNIAILLVDKEKPFQLAPNVQPIC--LPPPRIMYNYSQCYV 228
            |::.......|::.|        ....|::|.:||.      |...:|  |...||.| .|..|:
  Fly   113 VLDESAISGCTELALLKLDRGVTGQRFAMMLPEKEL------NSTWLCNSLGWGRIYY-VSYVYI 170

  Fly   229 SGWQRSDFGRAAILPKRW------------------TLYVLPPDQCRTKLRLSLLGRRHAHNDSL 275
            |....: |......|..|                  :.|...||..|.....|..||.:      
  Fly   171 SAMCPA-FSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECKPDCSRCLCMTSYTGRGN------ 228

  Fly   276 LCAGGDKGDFVCGDVDMTAVPLMCPLSGHDDRFHLAGLLTRTARCDGPQLLGIYTNVKLYRQWID 340
            :|. .|.|.           ||.|      |.| |.|:..|...||....: .|||:...|::|:
  Fly   229 MCQ-QDLGS-----------PLFC------DHF-LYGVARRVHTCDDEGFM-FYTNIYQNRKFIE 273

  Fly   341  340
              Fly   274  273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 PRK06406 <19..>80 CDD:235796
Tryp_SPc 105..339 CDD:214473 58/257 (23%)
CG30323NP_725729.2 COG5640 <50..280 CDD:444365 59/260 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.