DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG30187

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:258 Identity:59/258 - (22%)
Similarity:116/258 - (44%) Gaps:44/258 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 AKFGEFPWLVAVYGSDTYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVELEPQPHQQ 171
            |.|....|:.||:....::|.|.||....|:|.|||:.:.:::.|.|  |.::     :..|..:
  Fly    42 AAFQNSVWMAAVHNRTHFICGGTLIHKRFVLTAAHCIVDQDVQSVSL--GAYN-----KSDPADR 99

  Fly   172 RSVVETLVHPNY-TQMPLAHNIAILLVDKEKPFQLAPNVQPICLPPPRIMYNYSQ----CYVSGW 231
            :.|:..:||.:: .:....::|.:|.:..:..|...  ::|||:...:.|.|:.:    ....||
  Fly   100 KDVITAVVHSSFDVRASYENDIGLLKLSSDVIFNAL--IRPICIVLNKSMANHMRNMRTFKAFGW 162

  Fly   232 ------QRSDFGRAAILPKRWTLYVLPPDQCRTKLRLSLLGRRHAHNDSLLCAGGDKGDFVCGDV 290
                  :.||..:..||..      |..::|..:|.:       ..::..:|||...||...|| 
  Fly   163 GTLRGNKTSDILQTIILNH------LDREECYMELSV-------YPSEKQICAGVPSGDTCGGD- 213

  Fly   291 DMTAVPLMCP--LSGHDDRFHLAGLLT--RTARCDGPQLLGIYTNVKLYRQWIDLKLRERNLD 349
              :..||...  :.|..:|....|:::  :|: |||.   |:||::..:..||.:.:...:::
  Fly   214 --SGGPLTNDVFIQGIGNREVQFGIISVGKTS-CDGQ---GVYTDLMSFADWIKMTIERLSIE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 58/247 (23%)
Tryp_SPc 105..339 CDD:214473 57/246 (23%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 57/246 (23%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.