DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG30091

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:321 Identity:64/321 - (19%)
Similarity:120/321 - (37%) Gaps:77/321 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SRTTLDENCHYMEKCCNIPDKLPTPKIPEEMMSCPCGGRHDLWYYLRPLGYKQQEAKFGEF--PW 114
            |...|||:       |.:|.:| .|||        .||                 ...||.  ||
  Fly    19 SARLLDED-------CGVPMQL-IPKI--------VGG-----------------VDAGELKNPW 50

  Fly   115 LVAVYGSDTYLCSGALITPLAVITTAHCVQNSEMEKVR-------------LLAGEWDAAVELEP 166
            :..:..:|.::|.|::||...|:|.|||:...|...|:             |..||.:       
  Fly    51 MALIKTNDEFICGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEHN------- 108

  Fly   167 QPHQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICL-------PPPRIMYNYS 224
            .||:..:|....:|.::......::||:|.:.|...::  |.::|:|:       |...::..::
  Fly   109 HPHEIYNVERVYIHDSFAIQNYRNDIALLRLQKSIVYK--PQIKPLCILLNDQLKPQTDLIQEFT 171

  Fly   225 QCYVSGWQRSDFGRAAILPKRWTLYVLPPDQCRTKLRLSLLGRRHAHNDSLLCAGGDKGDFVCGD 289
               ..||..:..|:.:...:...:|.:....|....       .:..:..:.|||...|...|..
  Fly   172 ---AIGWGVTGNGKMSNNLQMVKIYRIDRKMCEAAF-------WYTFDYPMFCAGTAVGRDTCKR 226

  Fly   290 VDMTAVPLMCPLSGHDDRFHLAGLLTRTARCDGPQLLGIYTNVKLYRQWIDLKLRERNLDI 350
            .....:.:.....|......|..:.|.|..|.|   .|:||:|..:..:|:..:.:.::::
  Fly   227 DSGGPLYIHMLFDGIKRATQLGIVSTGTEDCRG---FGMYTDVMGHIDFIERIVLDADIEV 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 51/256 (20%)
Tryp_SPc 105..339 CDD:214473 51/255 (20%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 55/283 (19%)
Tryp_SPc 37..276 CDD:238113 55/285 (19%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435477
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.