DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG30090

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:295 Identity:74/295 - (25%)
Similarity:119/295 - (40%) Gaps:56/295 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 NCHYMEKCCNIPDKLPTPKIPEEMMSCPCGGRHDLWYYLRPLGYKQQEAKFGEFPWLVAVYGSDT 123
            |..|:|..|.:.......||        .|||               :|.....||:..::.|..
  Fly    21 NGEYLEPRCGLTANTIAFKI--------IGGR---------------DAIINSNPWMAYIHSSVK 62

  Fly   124 YLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVELE-------PQPHQQRSVVETLVHP 181
            .:|.|.|||...|:|.||||......||||  ||:|.....:       |:. ::..|.....|.
  Fly    63 LICGGTLITQRFVLTAAHCVNEGSAVKVRL--GEYDDTATEDCNSKICIPRA-EEHDVDMAFRHG 124

  Fly   182 NYTQMPLAHNIAILLVDKEKPFQLAPNVQPICL---PPPRIMYNYSQCYV-SGWQRSDFGRAAIL 242
            .::::...::||:|.:.|...|:  .::.|||:   ...|.:.:..:.:| :||     |.....
  Fly   125 KFSEIKNLNDIALLRLAKFVTFK--AHISPICIILGTSKRELVDSIEWFVATGW-----GETRTH 182

  Fly   243 PKRWTLYVLPPDQCRTKLRLSLLGRRHAHNDSLLCAGGDKGDFVCGDVDMTAVPLMCPLSGHDDR 307
            ..|..|.:....:..:...:..|||....|.  :|||....|...||   :..||...:. |.|:
  Fly   183 RTRGVLQITQLQRYNSSQCMQALGRLVQQNQ--ICAGRLGSDTCNGD---SGGPLFQTVR-HMDK 241

  Fly   308 FHLA--GLLTRTAR-CDGPQLLGIYTNVKLYRQWI 339
            ....  |:::..:| |.|   :|:||:|..|..||
  Fly   242 MRPVQFGVVSYGSRECSG---IGVYTDVYSYADWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 65/249 (26%)
Tryp_SPc 105..339 CDD:214473 63/247 (26%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 68/275 (25%)
Tryp_SPc 40..276 CDD:238113 69/276 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435465
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.