DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG30087

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:269 Identity:62/269 - (23%)
Similarity:112/269 - (41%) Gaps:44/269 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 CGGRHDLWYYLRPLGYKQQEAKFGEFPWLVAVYGSDTYLCSGALITPLAVITTAHCVQNSEMEKV 151
            ||..::....:|.:..|  ||.....|::|.|..:....|.|:::....::|.||||    ...:
  Fly    30 CGVTYESQTAMRVVNGK--EAVIRSAPFMVYVTNNSLTHCGGSILNSRYILTAAHCV----FPNL 88

  Fly   152 RLLAGEWDAAVELEPQ-----PH-QQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQ 210
            ||..||.:...:.:.|     |. ::..:::.:.|..|......::||:|.:::...|.:  ::|
  Fly    89 RLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSINFNV--HIQ 151

  Fly   211 PICLPPPRIMYNYSQCYVSGWQRSDFGRAAILPKRWTLYVLPPDQCRTKLRLSLLGRRHAH-NDS 274
            |||:    ::...|...|:.:|...:|..   .|....::|...:.|...........||: |.:
  Fly   152 PICI----LLNPASAPSVATYQTFGWGET---KKNGFPHLLQTAELRAYDAAYCSRSFHAYMNGN 209

  Fly   275 LLCAGGDKGDFVCGD--------VDMTAVPLMCPLSGHDDRFHLAGLLT-RTARCDGPQLLGIYT 330
            .:|||.::.|...||        ||...|          .|:...|::: ....|..|   |:||
  Fly   210 QICAGHEERDTCAGDSGGPLVTRVDFDGV----------KRYLQLGIVSYGPTDCQSP---GVYT 261

  Fly   331 NVKLYRQWI 339
            .|..|..||
  Fly   262 YVPNYINWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 58/251 (23%)
Tryp_SPc 105..339 CDD:214473 56/249 (22%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 58/256 (23%)
Tryp_SPc 42..272 CDD:238113 59/257 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435473
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.