DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG30082

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:285 Identity:76/285 - (26%)
Similarity:126/285 - (44%) Gaps:49/285 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 TPKIPEEMMSCPCGGRHDLWYYLRPLGYKQQEAKFGEFPWLVAVYGSDTYLCSGALITPLAVITT 139
            |||:..:.:...||...:|....|.:|  .:.|..|..|||..::.:.:.:|:|.|||...|:|.
  Fly    16 TPKLRAQFIDPNCGTTINLPPTNRIVG--GRTADIGSNPWLAYLHKNSSLVCTGTLITKRFVLTA 78

  Fly   140 AHCVQNSEMEKVRLLAGEWDAAVELE-------PQPHQQRSVVETLVHPNY-TQMPLAHNIAILL 196
            |||:.:..:..|||  ||:|.:..::       | .:::.||....:|..: .:....::|.:|.
  Fly    79 AHCLHSFHLLTVRL--GEYDTSTRIDCTSEFCIP-TYEEYSVENAYIHTFFGGRQDSRNDIGLLK 140

  Fly   197 VDKEKPFQLAPNVQPICL--PPPRIMYNYSQCYVSGWQRSDFGRAAILPKRWTLYVLPPDQCRTK 259
            ::....::|.  ::||||  .|.::.|: |....:||.:.|....|.:.:...|..|....|...
  Fly   141 LNGTVVYKLF--IRPICLFRDPGQVPYS-STYEAAGWGKIDLINTATVLQTVNLIRLDQSDCERS 202

  Fly   260 LRLSLLGRRHAHNDSLLCAGGDKGDFVCGDVDMTAVPLMCPLSGHDDRFHLAGLLTRTAR----- 319
            ||.||       :....|||..:.|...||   :..||...:|.        |.:|||.:     
  Fly   203 LRTSL-------SYGQFCAGQWRADTCSGD---SGGPLSRKMSN--------GRITRTVQLGIVS 249

  Fly   320 -----CDGPQLLGIYTNVKLYRQWI 339
                 |.||   |:||.|..:..||
  Fly   250 YGHYLCRGP---GVYTYVPSFTNWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 68/255 (27%)
Tryp_SPc 105..339 CDD:214473 66/253 (26%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 68/260 (26%)
Tryp_SPc 40..274 CDD:238113 69/261 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435474
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.