DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and F10

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens


Alignment Length:258 Identity:66/258 - (25%)
Similarity:105/258 - (40%) Gaps:39/258 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 QEAKFGEFPWLVAVYGSDTY-LCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVELEPQP 168
            ||.|.||.||...:...:.. .|.|.:::...::|.|||:..::..|||:    .|...|.|...
Human   239 QECKDGECPWQALLINEENEGFCGGTILSEFYILTAAHCLYQAKRFKVRV----GDRNTEQEEGG 299

  Fly   169 HQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLP----PPRIMYNYSQCYVS 229
            .....|...:.|..:|:.....:||:|.:  :.|.....||.|.|||    ....:.......||
Human   300 EAVHEVEVVIKHNRFTKETYDFDIAVLRL--KTPITFRMNVAPACLPERDWAESTLMTQKTGIVS 362

  Fly   230 GWQRS-DFGRAAILPKRWTLYVLPPDQCRTKLRLSLLGRRHAHNDSLLCAGGD-KGDFVC-GDVD 291
            |:.|: :.||.:...|...:..:..:.|  ||..|.:     ...::.|||.| |.:..| ||  
Human   363 GFGRTHEKGRQSTRLKMLEVPYVDRNSC--KLSSSFI-----ITQNMFCAGYDTKQEDACQGD-- 418

  Fly   292 MTAVPLMCPLSG------HDDRFHLAGLLTRTARCDGPQLLGIYTNVKLYRQWIDLKLRERNL 348
                      ||      ..|.:.:.|:::....|......||||.|..:.:|||..::.|.|
Human   419 ----------SGGPHVTRFKDTYFVTGIVSWGEGCARKGKYGIYTKVTAFLKWIDRSMKTRGL 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 62/248 (25%)
Tryp_SPc 105..339 CDD:214473 61/247 (25%)
F10NP_000495.1 GLA 25..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:317114
O-glycosylated at one site 183..203
Tryp_SPc 235..464 CDD:238113 63/249 (25%)
O-glycosylated at one site 476..485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.