DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and try-5

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:37 Identity:15/37 - (40%)
Similarity:18/37 - (48%) Gaps:5/37 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 PWLVAV-----YGSDTYLCSGALITPLAVITTAHCVQ 144
            ||.|.:     .|....:|.|.|||...|:|.|||.|
 Worm    55 PWAVQIRVKARKGDFEVICGGTLITLKHVLTAAHCFQ 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 15/37 (41%)
Tryp_SPc 105..339 CDD:214473 15/37 (41%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 15/37 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.