DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and F9

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_032005.1 Gene:F9 / 14071 MGIID:88384 Length:471 Species:Mus musculus


Alignment Length:416 Identity:93/416 - (22%)
Similarity:151/416 - (36%) Gaps:129/416 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CLLGSLVPSIAASKVCGPEKHCVPYEQCNEGLMVDGKFYPDRSRTTLDENCHY-----MEKCCNI 69
            ||.|.:.....:|..|          .|..|.  :|:      ...||..|:.     .:.|.|.
Mouse   102 CLNGGICKDDISSYEC----------WCQVGF--EGR------NCELDATCNIKNGRCKQFCKNS 148

  Fly    70 PDK------LPTPKIPEEMMSC------PCGGRHDLWY--------------------------- 95
            ||.      ....::.|:..||      || ||..:.|                           
Mouse   149 PDNKVICSCTEGYQLAEDQKSCEPTVPFPC-GRASISYSSKKITRAETVFSNMDYENSTEAVFIQ 212

  Fly    96 ---------------------YLRPLGYKQQEAKFGEFPWLVAVYGSDTYLCSGALITPLAVITT 139
                                 :.|.:|  .:.||.|:.||.|.:.|.....|.||:|....::|.
Mouse   213 DDITDGAILNNVTESSESLNDFTRVVG--GENAKPGQIPWQVILNGEIEAFCGGAIINEKWIVTA 275

  Fly   140 AHCVQNSEMEKVRLLAGEWDAAVELEPQPHQQRSVVETLVHPNY--TQMPLAHNIAILLVDKEKP 202
            |||::..  :|:.::|||::  ::.:....|:|:|:.|:.|..|  |....:|:||:|.:|  ||
Mouse   276 AHCLKPG--DKIEVVAGEYN--IDKKEDTEQRRNVIRTIPHHQYNATINKYSHDIALLELD--KP 334

  Fly   203 FQLAPNVQPICLPP---PRIMYNYSQCYVSGWQR-SDFGRAAILPKRWTLYVLPPDQCRTKLRLS 263
            ..|...|.|||:..   ..|...:...|||||.: .:.||.|.:.:...:.::....|......:
Mouse   335 LILNSYVTPICVANREYTNIFLKFGSGYVSGWGKVFNKGRQASILQYLRVPLVDRATCLRSTTFT 399

  Fly   264 LLGRRHAHNDSLLCAG----------GDKGDFVCGDVDMTAVPLMCPLSGHDDRFHLAGLLTRTA 318
            :.       :::.|||          ||.|.....:|:.|:              .|.|:::...
Mouse   400 IY-------NNMFCAGYREGGKDSCEGDSGGPHVTEVEGTS--------------FLTGIISWGE 443

  Fly   319 RCDGPQLLGIYTNVKLYRQWIDLKLR 344
            .|......||||.|..|..||..|.:
Mouse   444 ECAMKGKYGIYTKVSRYVNWIKEKTK 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 66/250 (26%)
Tryp_SPc 105..339 CDD:214473 65/249 (26%)
F9NP_032005.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011 8/44 (18%)
FXa_inhibition 134..170 CDD:291342 6/35 (17%)
Tryp_SPc 236..464 CDD:214473 67/256 (26%)
Tryp_SPc 237..467 CDD:238113 68/258 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.