DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG43336

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:248 Identity:68/248 - (27%)
Similarity:115/248 - (46%) Gaps:47/248 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 PWLVAVYGSD-TYLCSGALITPLAVITTAHCVQNSEMEKVRLLA--GEWDAAVELEPQPHQQRSV 174
            ||:..::.:| .::|.|:|||...|:|.|||.    :::..|:|  ||:|.  |.....|.....
  Fly    50 PWMAFLHSTDGRFICGGSLITNRLVLTAAHCF----LDRTELVARLGEYDR--EEYEMCHDSYCT 108

  Fly   175 --VETLV-----HPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLP-PPRIMYNYSQCYV--- 228
              :|.:|     |.:|..|.:|::||||.:.::  .|...|::|||:. .||     .:.|:   
  Fly   109 YRIEAMVERGFRHRHYNPMTMAYDIAILRLYRK--VQYTDNIRPICIVIDPR-----WRKYIDSL 166

  Fly   229 -----SGWQRSDF-GRAAILPKRWTLYVLPPDQCRTKLRLSLLGRRHAHNDSLLCAGGDKGDFVC 287
                 :||.:::. |.:|.| :...|....|:.||....|||...:       .|||.::.:...
  Fly   167 DPLTGTGWGKTESEGDSAKL-RTVDLARKHPEVCRRYATLSLTANQ-------FCAGNERSNLCN 223

  Fly   288 GDVDMTAVPLMCPLSGHDDRFHLAGLLTRT-ARCDGPQLLGIYTNVKLYRQWI 339
            || ....|..:.|. |...||...|:.:.| .:|   .::.::|:|..|..||
  Fly   224 GD-SGGPVGALIPY-GKSKRFVQVGIASFTNTQC---VMVSVFTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 68/248 (27%)
Tryp_SPc 105..339 CDD:214473 66/246 (27%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 66/246 (27%)
Tryp_SPc 40..271 CDD:238113 66/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435469
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.