DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG43110

DIOPT Version :10

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:139 Identity:30/139 - (21%)
Similarity:44/139 - (31%) Gaps:47/139 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 EYESFSDEDLKRKIRKLTKLGYSVLPEDTFAEMLDAINRMQENYAKVKVCDYRDNSKCDLALEPE 155
            :|.|...|  :|:::|         .|.....|:|.||. :.|...|:....:..   |..|..|
  Fly     7 QYSSLIKE--QRQLKK---------AETMLQSMIDKINH-ELNQLVVEELQIKSR---DAQLSVE 56

  Fly   156 LTEIMATSRDPEELKYYWQQWYDAAGAPTRDDFQKYVDLNGVAARMNNYSSGAEYWLSAYEDD-- 218
            .|.......||         ..|.|...|.:..|:.:||                   |.:||  
  Fly    57 TTTAKMVKPDP---------LLDVATCSTAEINQQKLDL-------------------AVQDDKL 93

  Fly   219 --TFEEQVD 225
              :.||..|
  Fly    94 LKSLEESED 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 PRK06406 <19..>80 CDD:235796
Tryp_SPc 105..339 CDD:214473 26/125 (21%)
CG43110NP_001246396.1 Tryp_SPc 36..257 CDD:238113 20/98 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.