DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG43110

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:283 Identity:71/283 - (25%)
Similarity:123/283 - (43%) Gaps:56/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 YMEKCCNIPDKLPTPKIPEEMMSCPCGGRHDLWYYLRPLGYKQQEAKFGEFPWLVAVYGSDTYLC 126
            ::::.|.   |.|.|||                  :......||.|::     :..::.:...||
  Fly    23 FLKQPCG---KTPVPKI------------------ISGSNASQQSAQY-----MAGIFNTTHLLC 61

  Fly   127 SGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVELEPQPHQQRSVVETLVHPNYTQMPLAHN 191
            .|.:|....|:|.||| ::::...|||  |.::.     ..|..|..|:||:.||.|:....|::
  Fly    62 GGTIIHEDFVLTVAHC-KSTQTLFVRL--GAYNI-----NHPTDQIRVIETIAHPQYSNSTYAND 118

  Fly   192 IAILLVDKEKPFQLAPNVQPICLPPPRIMYNYSQCY-VSGWQRSDFGRAAILPKRWTLYVLPPDQ 255
            ||::.:::...|.|  |:||||:.....:....:.| ..||.|:.....:.:.:|..:....|..
  Fly   119 IALVKLERSVIFNL--NIQPICIHLDATLGKQIRYYNAFGWGRTRNAEQSDILQRIFVNRTNPMI 181

  Fly   256 CRTKLRLSLLGRRHAHNDSLLCAGGDKGDFVCGDVDMTAVPLMCPLS----GHDDRFHLAGLLTR 316
            |...|.:|       .:...:||..|:||...||   :..||:..::    ..|.:|.:....||
  Fly   182 CHLYLGMS-------PDPKQICATTDQGDTCAGD---SGGPLISKITYQGKNFDTQFGITSYGTR 236

  Fly   317 TARCDGPQLLGIYTNVKLYRQWI 339
              .|:|   :|:||:|..|..||
  Fly   237 --ECNG---VGLYTDVSQYSGWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 64/240 (27%)
Tryp_SPc 105..339 CDD:214473 62/238 (26%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 65/266 (24%)
Tryp_SPc 36..257 CDD:238113 66/267 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435482
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.