DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG43125

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:268 Identity:62/268 - (23%)
Similarity:97/268 - (36%) Gaps:63/268 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 LWYYLRPLGYKQQEAK---FGEFPWLVAVYG--SDTYLCSGALITPLAVITTAHCVQNSEMEKVR 152
            |:|....|..:|...|   |...||||.:..  |....|:|.||....|:|.|.|:.......||
  Fly    14 LFYQGSALFLEQNCGKSSVFSPAPWLVKIRPELSSNITCTGTLINERFVLTAASCIDYQTELIVR 78

  Fly   153 LLAGEWDAAVELEPQ-PHQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLPP 216
            |  ||.|..::...: .:::..|...|:|.:|:.....:|||:|.:.....::  .|:||||:. 
  Fly    79 L--GEIDGTLQNSSKLQYEEIYVARALIHRSYSSESHQYNIALLRLKTSVVYK--KNIQPICID- 138

  Fly   217 PRIMYNYSQCYVSGWQRSDFGRAAILPKRWTLYVLPPDQCRTKLR------------LSLLGRRH 269
                             .:.|:   :||..|..:........|..            |||.|.|.
  Fly   139 -----------------VNVGK---VPKAPTFEIEKKKNEEPKKNKAGIMKRFLNWFLSLFGVRE 183

  Fly   270 AHNDSLLCAGGDKGDFVCGDVDMTAVPLMCPLS---GHDDRFHLAGLLTRTARCDGPQLLGIYTN 331
            ...|.:|              ....:.:..||:   .....||..|:|:..   :......:||:
  Fly   184 PRPDVIL--------------PPQPIAVGWPLTKQINESALFHQYGILSHR---NSESKKDVYTD 231

  Fly   332 VKLYRQWI 339
            |..|..||
  Fly   232 VMAYVNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 58/256 (23%)
Tryp_SPc 105..339 CDD:214473 56/254 (22%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 31/103 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435483
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.