DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9395 and AT5G48190

DIOPT Version :9

Sequence 1:NP_001162973.2 Gene:CG9395 / 34742 FlyBaseID:FBgn0032506 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_199630.1 Gene:AT5G48190 / 834872 AraportID:AT5G48190 Length:102 Species:Arabidopsis thaliana


Alignment Length:109 Identity:27/109 - (24%)
Similarity:45/109 - (41%) Gaps:19/109 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   533 KYLALVDLDEFIVPRYSDTLNELIGSLNQRFRNRNTGAYSFQNAFYYLQFADDSL-ASSGIEGGN 596
            |::...|:|||:.....:|::.::.||.:                 |.||..:.: .||.:....
plant     3 KWMFFFDVDEFLHVPVKETISSVMESLEE-----------------YFQFTIELMPMSSRVCYSG 50

  Fly   597 DQLARVRANLVTQRKTRRRYKLHPQKQRSKYICKPEAVVEAGNH 640
            |..||.......::...|..|..|::.| ||..:||.|...|.|
plant    51 DGPARTYRKWGIEKLAYRDVKKVPRRDR-KYAVQPENVFAIGVH 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9395NP_001162973.2 Glyco_transf_92 407..708 CDD:279961 27/109 (25%)
AT5G48190NP_199630.1 Glyco_tranf_GTA_type <2..>101 CDD:299700 27/109 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.