DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9395 and GALS3

DIOPT Version :9

Sequence 1:NP_001162973.2 Gene:CG9395 / 34742 FlyBaseID:FBgn0032506 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_193750.1 Gene:GALS3 / 827763 AraportID:AT4G20170 Length:504 Species:Arabidopsis thaliana


Alignment Length:299 Identity:68/299 - (22%)
Similarity:110/299 - (36%) Gaps:93/299 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 FAASRARNSSAKKGSPVGHPPPSGD---NIPDRIAVCVKP---LHFN----------YD-----Q 420
            |::..|.|.....|:.:.| ..:||   |:.|.|:|..:|   :.|:          ||     .
plant   185 FSSISAVNPQNSGGTLILH-ATTGDPTLNLTDSISVLTEPPKSVDFDLYNSTKKTKKYDYLYCGS 248

  Fly   421 ALY-------LMEYLEFYA-LLGV-SHFTFYNHTLGPHASCVLENYQKGLVPGNLTAHDLEALTP 476
            :||       :.|::.::. ..|. |||..  |..|.....|.|..:..:..|.:|.||:     
plant   249 SLYGNLSPQRVREWIAYHVRFFGERSHFVL--HDAGGIHEEVFEVLKPWIELGRVTLHDI----- 306

  Fly   477 AEAANNATPRVLRTQYQRPTVSILPWNLRMRSQKEIRTEGL----FAALNDCLYRTMYRYKYLAL 537
                                          |.|:  |.:|.    |..:||||:|..:..|::..
plant   307 ------------------------------RDQE--RFDGYYHNQFMIVNDCLHRYRFMTKWMFF 339

  Fly   538 VDLDEFIVPRYSDTLNELIGSLNQRFRNRNTGAYSFQNAFYYLQFADDSL-ASSGIEGGNDQLAR 601
            .|:|||:.....:|::.::.||.:                 |.||..:.: .||.|....|..||
plant   340 FDVDEFLHVPVKETISSVMESLEE-----------------YSQFTIEQMPMSSRICYSGDGPAR 387

  Fly   602 VRANLVTQRKTRRRYKLHPQKQRSKYICKPEAVVEAGNH 640
            .......::...|..|..|::.| ||..:||.|...|.|
plant   388 TYRKWGIEKLAYRDVKKVPRRDR-KYAVQPENVFATGVH 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9395NP_001162973.2 Glyco_transf_92 407..708 CDD:279961 59/266 (22%)
GALS3NP_193750.1 Glyco_transf_92 241..448 CDD:396317 55/242 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.