DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9395 and GALS1

DIOPT Version :9

Sequence 1:NP_001162973.2 Gene:CG9395 / 34742 FlyBaseID:FBgn0032506 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_565768.1 Gene:GALS1 / 817922 AraportID:AT2G33570 Length:496 Species:Arabidopsis thaliana


Alignment Length:361 Identity:75/361 - (20%)
Similarity:117/361 - (32%) Gaps:115/361 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 FFVYSAYFDRREGARLVRVVG-ATKTRGPERVWCRFWYGPS--AGNGTDAGSSTARAKYSSATVM 318
            |.:..||   |.|.....|:| |:|   |..|:.:.||...  :.|||              ::.
plant   112 FVLMGAY---RGGPTTFSVIGLASK---PIHVYGKPWYKCEWISNNGT--------------SIR 156

  Fly   319 ARVKIIRENWNL--KYSACFILCPVRTPPLSVPHFVSVVSRLRAPPGNLLTLRNTDQDADFAASR 381
            |:.:.|..:|..  .|:...:.|...:.|.|            ...|..|.|.....::.....|
plant   157 AKAQKILPDWGYGRVYTVVVVNCTFNSNPNS------------DNTGGKLILNAYYNESPKLFER 209

  Fly   382 ARNSSAKKG---SPVGHPPPSGDNIPDRIAVCVKPLHFNYDQALYLMEYLEFYALL--GVSHFTF 441
            ........|   .....||...|.:     .|...|:.|. .|..:.|::.::|..  ..|||.|
plant   210 FTTLEESAGIYDESKYSPPYQYDYL-----YCGSSLYGNV-SASRMREWMAYHAWFFGDKSHFVF 268

  Fly   442 YNHTLGPHASCVLENYQKGLVPGNLTAHDLEALTPAEAANNATPRVLRTQYQRPTVSILPW---- 502
                                       ||         |...:|.|.:.        :.||    
plant   269 ---------------------------HD---------AGGVSPEVRKV--------LEPWIRAG 289

  Fly   503 -----NLRMRSQKEIRTEGLFAALNDCLYRTMYRYKYLALVDLDEFIVPRYSDTLNELIG--SLN 560
                 |:|.:||.:......|..:||||:|..|...:....|:||:|...:.:||..::.  |:|
plant   290 RVTVQNIRDQSQYDGYYYNQFLIVNDCLHRYRYAANWTFFFDVDEYIYLPHGNTLESVLDEFSVN 354

  Fly   561 QRFR------------NRNTGAYSFQNAFYYLQFAD 584
            .:|.            |.::..|..|..|..|.|.|
plant   355 TQFTIEQNPMSSVLCINDSSQDYPRQWGFEKLLFKD 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9395NP_001162973.2 Glyco_transf_92 407..708 CDD:279961 44/203 (22%)
GALS1NP_565768.1 Glyco_transf_92 231..439 CDD:396317 45/210 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.