DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9395 and CG11127

DIOPT Version :10

Sequence 1:NP_609639.2 Gene:CG9395 / 34742 FlyBaseID:FBgn0032506 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_610283.1 Gene:CG11127 / 35673 FlyBaseID:FBgn0033178 Length:449 Species:Drosophila melanogaster


Alignment Length:151 Identity:32/151 - (21%)
Similarity:49/151 - (32%) Gaps:61/151 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 CTR--VTMDQFFTAHHELGHIQYYLQYQHQPSVYRSGANPGFHEAVGDVLSLSVSTPKHLEKIGL 425
            ||.  :|:.:|:....|:.:.|.||                  |...:|.|.|..|...||.||.
  Fly    21 CTECSITVRKFYNYTLEVQNTQSYL------------------ERECNVASKSSITITKLEPIGN 67

  Fly   426 LKDYVQDEESKLNQFYQAGLSKLVFLPFAYTLDKYRWGIFRGDIKPEEY------NCKFWEMRSK 484
            .     |||:..|                             |...|||      ..:.|::.|.
  Fly    68 C-----DEENDCN-----------------------------DADMEEYLDEESSTDESWKLSSS 98

  Fly   485 YSGIEPPVVRTEADFDAPAKY 505
            .:..:||.| .::....||::
  Fly    99 CTTDDPPYV-DDSRVQLPAQH 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9395NP_609639.2 Glyco_transf_92 406..708 CDD:426386 23/106 (22%)
CG11127NP_610283.1 PRK12323 347..>385 CDD:481241
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.