DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9395 and C35A5.10

DIOPT Version :10

Sequence 1:NP_609639.2 Gene:CG9395 / 34742 FlyBaseID:FBgn0032506 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_001023700.1 Gene:C35A5.10 / 3565313 WormBaseID:WBGene00044016 Length:286 Species:Caenorhabditis elegans


Alignment Length:115 Identity:30/115 - (26%)
Similarity:38/115 - (33%) Gaps:44/115 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 GGGGGGAGAFGVNVPLIPWGQVLPDKVEET--LPHFPFGTRPIDGAWQVVNGTRFKFFVYSAYFD 265
            |...||..|:|.    ||....:|.....|  ..:.|:|.:...|.:|  ||   :||       
 Worm   140 GTSNGGYNAYGT----IPVNVNVPSSSTNTNVNQYLPYGAQQFTGTYQ--NG---QFF------- 188

  Fly   266 RREGARLVRVVGATKTRG---------PE-------RVWCRFWYGPSAGN 299
                      .|||:..|         |.       .|.||...|.||||
 Worm   189 ----------CGATEPSGGVCRNNGVCPSGHSCVAGNVCCRCPVGSSAGN 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9395NP_609639.2 Glyco_transf_92 406..708 CDD:426386
C35A5.10NP_001023700.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.