DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9395 and CG11384

DIOPT Version :9

Sequence 1:NP_001162973.2 Gene:CG9395 / 34742 FlyBaseID:FBgn0032506 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster


Alignment Length:568 Identity:137/568 - (24%)
Similarity:215/568 - (37%) Gaps:120/568 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 WGQVLPDKVEETLPHFPFGTRPIDGA-----WQVVNGTRFKFFVYSAYFDRREGARL--VRVVGA 278
            |.:.:..|:.:|...:|   .|:|..     ||........|.:|:||.|:|:|.:|  ||::..
  Fly    89 WAKPMGYKINKTCAVYP---DPLDLQLHNIYWQTFVNANVTFRLYAAYLDKRKGLKLPTVRILAT 150

  Fly   279 TKTRGPE--RVWCRFWYGPSAGNGTDAGSSTARAKYSSATVMARVKIIRENW----NLKYSACFI 337
            ......|  ...|:.|:     .|.........|::.|..|        |.|    ||.|.. .:
  Fly   151 ANQIDNEFPPTHCQMWF-----EGYRQPIFVPVAEFLSVWV--------EAWGNKPNLNYPH-LL 201

  Fly   338 LCPVRT---PPL--SVPHFVSVVSRLRAPPGNLLTLRNTDQDADFAASRARNSSAKKGSPVGHPP 397
            .|||.:   ||.  |.|..||:|:|.....||.|.:               |.:.|:..||..||
  Fly   202 SCPVPSELPPPTVNSFPKTVSLVARHCEKAGNSLRV---------------NMNRKQSLPVVIPP 251

  Fly   398 ---PSGDNIP--------DRIAVCVKPLHFNY-DQALYLMEYLEFYALLGVSHFTFYNHTLGPHA 450
               |...|..        ....||:|...|.| |.:..|:|:.|...:||.|....|.:.:.|..
  Fly   252 SQNPKSQNATIQSQNEALQNFGVCLKGFDFPYVDLSERLIEWFELQRILGASRIYAYMYDVHPAV 316

  Fly   451 SCVLENYQKGLVPGNLTAHDLEALTPAEAANNATPRVLRTQYQRPTVSILPWNLRMRSQKEIRTE 515
            ..||:.||:   .|.|   :|..||.|    |..||:...|:.          |....:.|.|..
  Fly   317 QRVLDYYQR---TGYL---ELRPLTLA----NGMPRLRHYQHM----------LLQHRKLEKRLN 361

  Fly   516 GLFAALNDCLYRTMYRYKYLALVDLDEFIVPRYSDTLNELIGSLNQRFRNRNTGAYSFQ------ 574
            .|. ..|||.||.:||:.||..||:||.|:|         :|. |:.:......|::.:      
  Fly   362 ELI-PYNDCFYRNLYRHDYLVNVDVDEVIMP---------LGD-NRNWHQLVQKAHALEVEKGGK 415

  Fly   575 --NAFYYLQFADDSLASSGIEGGNDQLARVRANLVTQRKTRRRYKLHPQKQRSKYICKPEAVVEA 637
              ..|..|.|.:........|..|.:...:...|...:.|:|........:.:|........:..
  Fly   416 CAGRFPALCFINSYFTKVPTEFSNHEEQAIAGELYVLQHTQRIKNYSMPGRATKCFHNARLSLTL 480

  Fly   638 GNHFVWEFAPG---KGSLNVPPKEAILQHYRVCEFGGNDCIKAPSIV-DRTTTKYVNRLVQRVDA 698
            .|||..::.||   ..:||.  ..|.:||||    ..:|.....::. ||:..|:...|...|:.
  Fly   481 HNHFTLKWLPGGCNPRTLNT--SIAQMQHYR----EPDDKYNLTNLTDDRSVWKFAGELRAAVEY 539

  Fly   699 VYRHLRQRCDLPALPPLLKTKENPQEKPVEITKKKPEENTNDKTKEKP 746
            |:.|         |..:|....:|:|:..::.:...:|..:...:::|
  Fly   540 VWLH---------LDDVLAQVSDPEEQQQQLEESLDQEGDDLDREQQP 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9395NP_001162973.2 Glyco_transf_92 407..708 CDD:279961 79/313 (25%)
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 81/325 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435055
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.