DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9395 and CG3655

DIOPT Version :9

Sequence 1:NP_001162973.2 Gene:CG9395 / 34742 FlyBaseID:FBgn0032506 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_001259118.1 Gene:CG3655 / 31056 FlyBaseID:FBgn0040397 Length:596 Species:Drosophila melanogaster


Alignment Length:485 Identity:127/485 - (26%)
Similarity:197/485 - (40%) Gaps:123/485 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 WQVVNGTRFKFFVYSAYFDRREGARL---VRVVGATKTRGPE-RVWCRFWYGPSAGNGTDAGSST 307
            ||.:..:...|.::.||:|.|..:.|   ||::|......|: :.:|:||:.   |........|
  Fly   129 WQTLRTSNGTFQLFGAYYDIRRTSLLGPTVRILGMIDRIEPKVKTYCQFWFD---GQKEPFIVKT 190

  Fly   308 ARAKYSSATVMARVKIIRENW-NLK---YSACFILCPVRTPPLS-VPHFVSVVSRLRAPPGNLLT 367
            ...||          |....| |.|   |....|.|.:..|... ||..||:|            
  Fly   191 FEYKY----------IWYNKWGNYKQGIYQPYLIACQIPKPFHGVVPSSVSMV------------ 233

  Fly   368 LRNTDQDADFAASRARNSSAKKGSPVGHPPPSGDNIPDRIAVCVKPLHFNYDQ-ALYLMEYLEFY 431
                :::.|.|.:..|        .:.:.||  |:.....|||||.|.|.||. ::.|:|::|..
  Fly   234 ----EKECDTATNNLR--------VIYNRPP--DDQKKGFAVCVKGLDFLYDDLSVRLIEWIEML 284

  Fly   432 ALLGVSHFTFYNHTLGPHASCVLENY-QKGLV-------PG---NLTAHDLEALTPAEAANNATP 485
            .:||.....|||..:.|:.:.||.:| |:|.|       ||   |:.......||.         
  Fly   285 NILGADKIYFYNLQVHPNITKVLNHYEQEGKVQVIPLTLPGGQPNVPGFQHLYLTK--------- 340

  Fly   486 RVLRTQYQRPTVSILPWNLRMRSQKEIRTEGLFAALNDCLYRTMYRYKYLALVDLDEFIVPRYSD 550
               :|.::|.. .::|:                   |||||:.:|.|.|:||:|:||.|:|:...
  Fly   341 ---KTNHKRQN-EVIPY-------------------NDCLYKNLYLYDYIALLDIDEVIMPKGGA 382

  Fly   551 TL-NELIGSL---NQRFRNRNTGAYSFQNAFYYLQFADDSLASSGIEGGNDQLARVRANLVTQRK 611
            .| :||:..:   :::.:.....:|:|:|.:    |.||....   .|.:..:.:....|  |..
  Fly   383 VLWSELMDKVRPESRKIKPDGFHSYNFRNVY----FLDDQQHE---HGWHKDIPKYMHML--QHV 438

  Fly   612 TRRRYKLHPQKQRSKYICKPEAVVEAGNHFVWEFAPGK-GSLNVPPKEAILQHYRVCEFGGNDCI 675
            .|.:....| .|..|....||.|:...|||......|. .|..|..|:|.|||||.      ||:
  Fly   439 HRAKNYTKP-NQYVKCFHDPERVLTLHNHFPLSCLGGVCKSYPVDTKDAQLQHYRA------DCV 496

  Fly   676 KA----------PSIVDRTTTKYVNRLVQR 695
            |.          .|:.|:|..||.:.|::|
  Fly   497 KTLKKSCEEYREHSVEDKTIWKYKDELIRR 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9395NP_001162973.2 Glyco_transf_92 407..708 CDD:279961 89/316 (28%)
CG3655NP_001259118.1 Glyco_transf_92 257..527 CDD:279961 89/318 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435056
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.