DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9395 and Y105C5B.25

DIOPT Version :9

Sequence 1:NP_001162973.2 Gene:CG9395 / 34742 FlyBaseID:FBgn0032506 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_502914.1 Gene:Y105C5B.25 / 190901 WormBaseID:WBGene00013662 Length:462 Species:Caenorhabditis elegans


Alignment Length:471 Identity:90/471 - (19%)
Similarity:162/471 - (34%) Gaps:125/471 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 NGTRFKFFVYSAYFDRREGARLVRVVGATKTRGPERVWCRFWYGPSAGNGTDAGSSTARAKYSSA 315
            |.|.........|.|.      :.:...|:....::::||::         |...:..|......
 Worm    79 NNTEISILAAYVYPDH------ISITLITQHSIKKQLYCRYY---------DCKRNEIRGSAWLG 128

  Fly   316 TVMARVKIIRENWNLKYSACFILCPVRTPPLSVPHFVSVVSRLRAPPGNLLTLRNTDQDADFAAS 380
            ||              :....|.||.|..    ..||||             ..|.::::|.   
 Worm   129 TV--------------FPESVIQCPRRIG----AEFVSV-------------SENLEKESDI--- 159

  Fly   381 RARNSSAKKGSPVGHPPPSGDNIPDRIAVCVKPLHFNYDQALYLMEYLEFYALLGVSHFTFYNHT 445
                      :|||......:.....::|||.|::.|....|.:::::|...|.|.|:|.||...
 Worm   160 ----------TPVGLTFRVFEEPIHELSVCVAPMYGNEPSWLPIIDFVEHNKLEGASYFYFYVGE 214

  Fly   446 LGPHASCVLENYQKGLVPGNLTAHDLEALTPAEAANNATPRVLRTQYQRPTVSILPWNLRMRSQK 510
            :..:...:|::|        :...|:|.:.            |:.:|.|..::   |:|      
 Worm   215 IRDYDQKILDDY--------VRTGDIELVK------------LQDKYHRVFIA---WHL------ 250

  Fly   511 EIRTEGLFAALNDCLYRTMYRYKYLALVDLDEFIVPRYSDTLNELIGSLNQRFRNRNTGAYSFQN 575
                    ..:.||..|:.|..|:.|.:||||.:......|:.:::.|:    ::.:.|....|:
 Worm   251 --------LQIQDCHLRSAYHSKWTAFIDLDERLSTNGPGTMIDVLRSI----QDSSVGEVQLQS 303

  Fly   576 AFYYLQFADDSLASSGIEGGNDQLARVRANLVTQRKTRRRYKLHPQKQRSKYICKPEAVVEAGNH 640
            . ..::..|.......||....:|...:.| .|.:||         ...:|.|.|.|.:.....|
 Worm   304 T-TIVKDQDYPDKYENIEQLEQELIFKKYN-ETVKKT---------MSGTKPIIKSEKIGLMSIH 357

  Fly   641 FVWEFAPGKGSLNVPPKEAILQHYRVCE--FGGNDCIKAPS------------IVDRTTTKYVNR 691
            .......|..:|.:....|.::|.|..:  ..|:|..|.|.            :.|..:.|....
 Worm   358 QASAKYFGVKTLLLNITVASVRHLRSVKHRISGSDWNKMPDETGNPIEFVTRPLPDEFSGKLREA 422

  Fly   692 LVQRVDAVYRHLRQRC 707
            :|:||..||..:...|
 Worm   423 VVKRVLHVYETIPVNC 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9395NP_001162973.2 Glyco_transf_92 407..708 CDD:279961 66/315 (21%)
Y105C5B.25NP_502914.1 Glyco_transf_92 174..419 CDD:366762 59/296 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4723
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.