DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9395 and R08C7.4

DIOPT Version :9

Sequence 1:NP_001162973.2 Gene:CG9395 / 34742 FlyBaseID:FBgn0032506 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_500564.4 Gene:R08C7.4 / 187696 WormBaseID:WBGene00019948 Length:463 Species:Caenorhabditis elegans


Alignment Length:332 Identity:75/332 - (22%)
Similarity:134/332 - (40%) Gaps:84/332 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 IAVCVKPLHFNYDQALYLMEYLEFYALLGVSHFTFYNHTLGPHASCVLENYQKGLVPGNLTAHDL 471
            ::|||.|::....:.|.::||:|.|.|:|.|||.|....:..:...:::||              
 Worm   183 LSVCVGPMYGEESKWLEIIEYVEHYRLVGTSHFYFTLFNMNEYDRKIIDNY-------------- 233

  Fly   472 EALTPAEAANNATPRVLRTQYQRPTVSILPWNLRMRSQKEIRTEGLFAALNDCLYRTMYRYKYLA 536
            |:|..||:..      ..|:|.|     |.|...:     ::|       ::|.||:.:..|::.
 Worm   234 ESLGIAESTK------YTTEYLR-----LGWMFHL-----LQT-------HECHYRSKFHSKWVV 275

  Fly   537 LVDLDEFIVPRYSDTLNELIGSLNQRFRNR----NTGAYSF------QNAFYYLQFADDSLASSG 591
            .:|:||.:|  |:       |.||.|...|    |.|..||      :.....::::.|:...  
 Worm   276 NMDIDERLV--YT-------GPLNLRSYLRRLPPNIGEVSFTTNRVLKTEPVPVKYSSDAQLM-- 329

  Fly   592 IEGGNDQLARVRANLVTQRKTRRRYKLHPQKQRSKYICKPEAVVEAGNHFVWEFAPGKGSLNVPP 656
                 :.:..::.|..|:...   |.|       |.|.:||.|.....|:.:....|...::||.
 Worm   330 -----EDMLFLKYNKTTEISW---YNL-------KGIIRPEKVAMLFYHWSYFQFEGVNVVSVPK 379

  Fly   657 KEAILQHYRVCE---FGGN--DCIKAPSIVDRTTTKYVNRLV----QRVDAVYRHLRQRCDLPAL 712
            :...::|||..:   ..||  :.........|.:..:..||:    :||..||.....||:  .:
 Worm   380 RFGHVRHYRNMDKKALNGNWMENYNGTLQETRLSRSFEKRLISAVRRRVKYVYDQRMVRCE--EI 442

  Fly   713 PPLLKTK 719
            |..|.::
 Worm   443 PEWLSSR 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9395NP_001162973.2 Glyco_transf_92 407..708 CDD:279961 72/319 (23%)
R08C7.4NP_500564.4 Glyco_transf_92 181..428 CDD:366762 67/307 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4723
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.