powered by:
Protein Alignment CG9395 and M02F4.2
DIOPT Version :9
Sequence 1: | NP_001162973.2 |
Gene: | CG9395 / 34742 |
FlyBaseID: | FBgn0032506 |
Length: | 840 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_508519.2 |
Gene: | M02F4.2 / 187401 |
WormBaseID: | WBGene00019736 |
Length: | 135 |
Species: | Caenorhabditis elegans |
Alignment Length: | 81 |
Identity: | 17/81 - (20%) |
Similarity: | 30/81 - (37%) |
Gaps: | 18/81 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 414 LHFNYDQALYLMEYLEFYALLGVSHFTFYNHTLGPHASCVLENYQKGLVP---GNLTAHDLEALT 475
||..:|......|.:| ..||::.:....|.: :.||..:. |:|.....:.:
Worm 40 LHHRFDAKWKRGEEVE-------KLFTYFPNNTSAHVA----SMQKTAITIFNGSLPVFSFDFI- 92
Fly 476 PAEAANNATPRVLRTQ 491
:..||.. |.:.||
Worm 93 --KGLNNCV-RQMETQ 105
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG9395 | NP_001162973.2 |
Glyco_transf_92 |
407..708 |
CDD:279961 |
17/81 (21%) |
M02F4.2 | NP_508519.2 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D561250at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.