DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9395 and K08D9.2

DIOPT Version :9

Sequence 1:NP_001162973.2 Gene:CG9395 / 34742 FlyBaseID:FBgn0032506 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_001343687.1 Gene:K08D9.2 / 187146 WormBaseID:WBGene00019524 Length:465 Species:Caenorhabditis elegans


Alignment Length:411 Identity:88/411 - (21%)
Similarity:139/411 - (33%) Gaps:141/411 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 PVRTPPLSV---PHFVSVVSRLRAPPGNLLTLRNTDQDADFAASRARNSSAKKGSPVGHPPPSGD 401
            |.:|.|:||   |..|.|         ..:::..||                  :.|.|.|    
 Worm   138 PTQTAPMSVVTCPRRVGV---------EFVSVSFTD------------------NHVPHEP---- 171

  Fly   402 NIP----------DRIAVCVKPLHFNYDQALYLMEYLEFYALLGVSHFTFYNHTLGPHASCVLEN 456
             ||          ..:||||.||.....:.|.:.|.:|.|.|||..:|.|   ||          
 Worm   172 -IPLIYRAYNEPIYELAVCVGPLFGTESKWLQIAESVEHYRLLGAKYFYF---TL---------- 222

  Fly   457 YQKGLVPGNLTAHDLEALTPAEAANNATPRVLRTQYQRPTVSILPWNLRMRSQKEIRTEGLFAAL 521
                   .|:..:|.:.|:.......|......||:::     |.|...     .|:|:      
 Worm   223 -------FNINEYDFKILSYYAKFGYAEYTHYITQHKK-----LNWKAH-----SIQTQ------ 264

  Fly   522 NDCLYRTMYRYKYLALVDLDEFIVPRYSDTLNELIGSLNQRFRNRNTGAYSFQNAFYYLQFADDS 586
             :|.||:.:..|::..||:||.:|..:||:|...:.:|.......|                   
 Worm   265 -ECHYRSRFHSKWVINVDIDERLVWTHSDSLLHFLRTLPPTIAKIN------------------- 309

  Fly   587 LASSGIEGGNDQLARVRANLVTQRKTRRRYKLHPQKQRSKY-------------ICKPEAVVE-A 637
            :|:|.:|......|          |.....:||.:....||             :.:||.:.. :
 Worm   310 IATSSVEKTGKSPA----------KMHNFSELHSELMFLKYNKTGEIKWSNFKGMYRPEKIFTLS 364

  Fly   638 GNHFVW-EFAPGKGSLNVPPKEAILQHYRVCEFGG-----NDCIKAPSIVDRTTTKYVNRL---- 692
            ||   | ........:.|.||.  :.|:|..:..|     ....|..|...|....:.|:|    
 Worm   365 GN---WSNLEENYVHVMVMPKR--IGHFRKYKNTGAHRPEGYSFKHSSEETRLDPTFENQLATNV 424

  Fly   693 VQRVDAVYRHLRQRC-DLPAL 712
            :::|..||.....|| :||.:
 Worm   425 LEKVGYVYNQRGIRCEELPEI 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9395NP_001162973.2 Glyco_transf_92 407..708 CDD:279961 71/325 (22%)
K08D9.2NP_001343687.1 Glyco_transf_92 184..427 CDD:366762 66/313 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.