DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9395 and F39G3.2

DIOPT Version :9

Sequence 1:NP_001162973.2 Gene:CG9395 / 34742 FlyBaseID:FBgn0032506 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_504273.2 Gene:F39G3.2 / 185501 WormBaseID:WBGene00018207 Length:467 Species:Caenorhabditis elegans


Alignment Length:366 Identity:71/366 - (19%)
Similarity:121/366 - (33%) Gaps:128/366 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 HPPPSGDNIPDRIAVCVKPLHFNYDQALYLMEYLEFYALLGVSHFTFYNHTLGPHASCVLENYQK 459
            ||...|.     ..|||:|::: |.:...:..::|.:...||:.|..|.|:.......:||.|: 
 Worm   161 HPKRKGG-----FTVCVQPVYW-YSEYHNIALFIETWRSQGVTRFIVYYHSSTTQVRNLLEYYR- 218

  Fly   460 GLVPGNLTAHDLEALTPAEAANNATPRVLRTQYQRPTVSILPW------------NLRMRS-QKE 511
                 ||                   .:||         :.||            ||::.| ...
 Worm   219 -----NL-------------------GILR---------LRPWPSFGRLPTRLFPNLKLPSFDSS 250

  Fly   512 IRTEGLFAALNDCLYRTMYRYKYLALVDLDEFIVPRYSDTLNELIGSLNQRFRNRNTGAYSFQNA 576
            ....|...|.|.|...  .:.:..|:.|.||.:|   :|. ..||..:.:..:....||.||.:.
 Worm   251 TYRVGHTLAQNLCALE--MKTEIGAIADFDEVMV---ADK-EMLINYVEEAMKPDEVGALSFSHL 309

  Fly   577 FYYLQ---------------FAD--------------DSLASSGIEG--GNDQLARVRANLVTQR 610
            ....:               |.|              |.:.:..|..  ||:...|...:|:   
 Worm   310 LVKFEPKISTMDFHGVVKPVFLDRNGPPKTIFNSSAVDIIVTHSIRRFIGNETTIRANGSLL--- 371

  Fly   611 KTRRRYKLHPQKQRSKYICKPEAV-----------VEAGNHFVWEFAPGKGSLNVPPKEAILQHY 664
                .|:.:.....:|.:.||.::           ::.....|:      || ::||..:...|.
 Worm   372 ----HYRHNSYTDPAKEVQKPYSLFTSYPNLHIKRIQKTLRKVF------GS-SIPPYNSTYLHV 425

  Fly   665 RVCEFGGNDCIKAPSIVD----RTTTKYVNRLVQRV-DAVY 700
            .      |.||  ..||.    |:|.:|..:.::.: |.||
 Worm   426 L------NQCI--TKIVGEGKCRSTVEYCKQWMEPLTDWVY 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9395NP_001162973.2 Glyco_transf_92 407..708 CDD:279961 68/354 (19%)
F39G3.2NP_504273.2 Glyco_transf_92 167..411 CDD:366762 51/296 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.