DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9395 and F36F12.3

DIOPT Version :9

Sequence 1:NP_001162973.2 Gene:CG9395 / 34742 FlyBaseID:FBgn0032506 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_001300099.1 Gene:F36F12.3 / 185362 WormBaseID:WBGene00018094 Length:251 Species:Caenorhabditis elegans


Alignment Length:318 Identity:71/318 - (22%)
Similarity:121/318 - (38%) Gaps:93/318 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   409 VCVKPLHFNYDQALYLMEYLEFYALLGVSHFTFYNHTLGPHASCVLENYQK-GLVPGNLTAHDLE 472
            :||.|.:....:.|.|:|::|...:..||.|.|....:..::...|:.|:: |:           
 Worm     1 MCVGPFYGADRKWLQLVEFVEHMRIFEVSMFFFTVFDMDAYSRLALDEYERQGI----------- 54

  Fly   473 ALTPAEAANNATPRVLRTQYQRPTVSILPWNLRMRSQKEIRTEGLFAALNDCLYRTMYRYKYLAL 537
                      |...|::|:|::     |.|...:            ..|:||.:|:.|..:::..
 Worm    55 ----------AETTVIQTEYEQ-----LDWMFHL------------LQLHDCFHRSKYISRWVIN 92

  Fly   538 VDLDE-FIVPRYSDTLNELIGSLNQRFRNRNTGAYSFQ-----------NAFYYLQFADDSLASS 590
            .|:|| |::.:...||.:|:     |.::.|.|..:||           ..|..||         
 Worm    93 ADIDERFVMFQPETTLIQLL-----RSQDANVGELNFQARRIQKTENSPQKFTNLQ--------- 143

  Fly   591 GIEGGNDQLARVRANLVTQRKTRRRYKLHPQKQRSKYICKPEAVVEAGNHFVWEFAPGKGSLNVP 655
                  |.:..:.| |..:..||.:.     .:.||.|.:||.|.....|......||....|||
 Worm   144 ------DTIENLEA-LKFRNTTRTQI-----WESSKSIYRPEMVAVQTYHHTHLQYPGVIVKNVP 196

  Fly   656 PKEAILQHYRVCE----------FGGNDCIKAPSIVDRTTTKYVNRLVQRVDAVYRHL 703
            .:.|..:|||:..          :|.|..|   :.:||...|.   ||.:|..:..|:
 Worm   197 RETAGFRHYRMTSVRNSIGNGWIYGDNFTI---TELDRELEKL---LVHKVANMAEHI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9395NP_001162973.2 Glyco_transf_92 407..708 CDD:279961 71/318 (22%)
F36F12.3NP_001300099.1 Glyco_transf_92 1..237 CDD:366762 67/305 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.