DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9395 and F07G11.4

DIOPT Version :9

Sequence 1:NP_001162973.2 Gene:CG9395 / 34742 FlyBaseID:FBgn0032506 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_001379664.1 Gene:F07G11.4 / 184159 WormBaseID:WBGene00017231 Length:499 Species:Caenorhabditis elegans


Alignment Length:270 Identity:54/270 - (20%)
Similarity:96/270 - (35%) Gaps:107/270 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 IAVCVKPLHF-----NYDQALYLME----YLEFYALLGVSHFTFYNHTLGPHASCVLENYQKGLV 462
            :.||:.||..     |:..|:::.:    ::..|.:..|:  ||||         :::.|:.   
 Worm   151 VVVCIAPLFVSEQWQNFLFAVHIYKKYGAFVNLYLISAVN--TFYN---------LMKEYEG--- 201

  Fly   463 PGNLTAHDLEALTPAEAANNATPRVLRTQYQRPTVSILPW-NLRM----------RSQKEIRTEG 516
            .|.|                               |:.|| :::.          .:|.|:|:: 
 Worm   202 DGYL-------------------------------SVQPWASVKFHGISKKIADTHNQIELRSQ- 234

  Fly   517 LFAALNDCLYRTMYRYKYLALVDLDEFIVPRYSDTL----------NELIGSLNQRFRNRNTGA- 570
             .||.:|||.:.....:::..:|||:.::||.:.|.          ||.|..|..:..|.|... 
 Worm   235 -VAAQSDCLLQYKEAARFITFLDLDDILIPRLAPTYAEEFQKLFDKNEQISYLFYQKENYNAVVT 298

  Fly   571 -----YSFQNAF---YYLQFADDSLASSGIEGGNDQLARVRANLVTQRKTRRRYKLH--PQKQRS 625
                 :|.:|.|   .|..|.         |.|...:..:|.|..:         ||  ||..::
 Worm   299 RYGVRFSLKNMFGSMTYKHFR---------ETGKSVVDPLRVNFTS---------LHFPPQTPKT 345

  Fly   626 -KYICKPEAV 634
             |||.....:
 Worm   346 EKYIVSENVI 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9395NP_001162973.2 Glyco_transf_92 407..708 CDD:279961 54/270 (20%)
F07G11.4NP_001379664.1 Glyco_transf_92 149..404 CDD:396317 54/270 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.