DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9395 and E03H4.5

DIOPT Version :9

Sequence 1:NP_001162973.2 Gene:CG9395 / 34742 FlyBaseID:FBgn0032506 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_493148.1 Gene:E03H4.5 / 184020 WormBaseID:WBGene00008473 Length:458 Species:Caenorhabditis elegans


Alignment Length:198 Identity:47/198 - (23%)
Similarity:83/198 - (41%) Gaps:53/198 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 IAVCVKPLHFNYDQALYLMEYLEFYALLGVSHFTFYNHTLGPHASCVLENYQK-GLVP------- 463
            :.:||.|::: |.|...::.|:|.:...|.|.|..:.|:.......|||.|:. |::.       
 Worm   161 LTMCVLPVYY-YSQWQNIVLYIEAWRAHGTSRFIVFFHSATKDTWKVLEYYRNLGIIEIRPWPNF 224

  Fly   464 GNLTAHDLEALTPAEAANNATPRVLRTQYQRPTVSILPWNLRMRSQKEIRTEGLFAALNDCL--Y 526
            |||         |:|.|:. .|::..:.|      |..:               |.|||.|:  .
 Worm   225 GNL---------PSEIADK-YPKIDNSVY------IFSY---------------FLALNLCILDI 258

  Fly   527 RTMYRYKYLALVDLDEFIVPRYSDTLNELIGSLNQRFRNRNTGAYSFQNAFYYLQFADDSLASSG 591
            :|...    ::.|.||.:|| ::.|:.|.   .::.....|.||..|:|::..|   :.|:..:|
 Worm   259 KTTIG----SVADFDEVMVP-HNGTMLEY---ASKEMTGTNVGALLFKNSYVSL---EPSIYDNG 312

  Fly   592 IEG 594
            ..|
 Worm   313 FSG 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9395NP_001162973.2 Glyco_transf_92 407..708 CDD:279961 47/198 (24%)
E03H4.5NP_493148.1 Glyco_transf_92 159..395 CDD:366762 47/198 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.