DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9395 and D1014.6

DIOPT Version :9

Sequence 1:NP_001162973.2 Gene:CG9395 / 34742 FlyBaseID:FBgn0032506 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_505096.1 Gene:D1014.6 / 183897 WormBaseID:WBGene00017019 Length:477 Species:Caenorhabditis elegans


Alignment Length:378 Identity:75/378 - (19%)
Similarity:135/378 - (35%) Gaps:96/378 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 SVVSRLRAPPGNLLTLRNTDQDADFAASRARNSSAKKGSPVGHPPPSGDNIPDRIAVCVKPLHFN 417
            |.|...|.|....:::..|.::           .|:...|:   .|..:|.|....||:..|:.:
 Worm   172 STVFCARRPGAKYISISKTTEE-----------QAELPIPI---VPRIENPPHYFTVCMATLYGD 222

  Fly   418 YDQALYLMEYLEFYALLGVSHFTFYNHTLGPHASCVLENYQKGLVPGNLTAHDLEALTPAEAANN 482
            ..:.|.:::::|:|.|.|.:.|..|...        :.||.:.|:...:...|:|.:.       
 Worm   223 EPKFLQIVDFIEYYKLQGATFFHIYLRN--------VSNYDRVLLDDYVRTGDIEIIK------- 272

  Fly   483 ATPRVLRTQYQRPTVSILPWNLRMRSQKEIRTEGLFAALNDCLYRTMYRYKYLALVDLDEFIVPR 547
                 :...:.|..   ..|:              .|.:|||.:|:.:..|:.|::|:||.|..|
 Worm   273 -----MHDHFWRDD---FMWH--------------NAQINDCHHRSKFFSKWTAVIDIDERIEMR 315

  Fly   548 YSDTLNELIGSLNQRFRNRNTGAYSFQNAFYYLQFADDSLASSGIEGGNDQLARVRANLVTQRKT 612
             |::...:| ||....|:.|     ..|..:.:|:.        |:|.:     ..|..|.:::.
 Worm   316 -SESFKTII-SLLDSIRDPN-----IVNLHFKVQWV--------IKGSD-----TPAEYVNEKEL 360

  Fly   613 RRRYKLHPQKQRS---------KYICKPEAVVEAGNHFVWEFAPGKGSLNVPPKEAILQHYRVCE 668
            ......|..:..|         |.|.:||.:.....|.......|.....|.....:::|||..|
 Worm   361 IDEIIFHKYQNTSQIGGFWNQPKCIIRPEKIGMMTIHAPMTTYSGLRRSLVNETIGVVRHYRNVE 425

  Fly   669 ---FGGN----------DCIKAPSIVDRTTTKYVNRLVQRVDAVYRHLRQRCD 708
               |.|.          :....|..:|...|   :.::.||..||..:...||
 Worm   426 QRVFAGALERMMVHAPFNIYPIPKWIDELLT---DAILNRVKWVYNVVDVSCD 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9395NP_001162973.2 Glyco_transf_92 407..708 CDD:279961 63/322 (20%)
D1014.6NP_505096.1 Glyco_transf_92 210..455 CDD:366762 58/301 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4723
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.