DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9395 and C08B6.3

DIOPT Version :9

Sequence 1:NP_001162973.2 Gene:CG9395 / 34742 FlyBaseID:FBgn0032506 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_505599.2 Gene:C08B6.3 / 182389 WormBaseID:WBGene00007424 Length:439 Species:Caenorhabditis elegans


Alignment Length:314 Identity:68/314 - (21%)
Similarity:115/314 - (36%) Gaps:64/314 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 IAVCVKPLHFNYDQALYLMEYLEFYALLGVSHFTFYNHTLGPHASCVLENYQKGLVPGNLTAHDL 471
            ::.|:.|::....:.|.|.|.:|.|.|.|::||.||...:..::|.:|.:|.:   .|.:....|
 Worm   176 LSFCMSPIYGKEAKWLLLAEIIEHYKLQGMTHFYFYIFHIDEYSSAMLNDYVR---TGEVEVTYL 237

  Fly   472 EALTPAEAANNATPRVLRTQYQRPTVSILPWNLRMRSQKEIRTEGLFAALNDCLYRTMYRYKYLA 536
            :                    :|....:|.|.:              .|..||..|:.:..|:..
 Worm   238 Q--------------------ERNDRELLHWQM--------------VAFRDCTLRSRFESKWSL 268

  Fly   537 LVDLDE-FIVPRYSDTLNELIGSLNQRFRNRNTGAYSFQNAFYYLQFADDSLASSGIEGGNDQLA 600
            ..|:|| .::.:|..|:.:.:..:|.   .:..|....|......:|..|...      |:.|:.
 Worm   269 FSDIDERLLMTKYPGTILDYLKEVND---PKIAGVQYRQQWIMKTEFMPDKYE------GDKQID 324

  Fly   601 RVRANLVTQRKTRRRYKLHPQKQRSKYICKPEAVVEAGNHFVWEFAPGKGSLNVPPKEAILQHYR 665
            .....|    :........|.....|.|..||.|.....|......||.....:.|:|.|::|||
 Worm   325 EWSPTL----RWHNSSVFGPPGHTVKCIIMPEKVFAMWTHRPTMIFPGFYVHELTPEEGIIRHYR 385

  Fly   666 VCEF--GGNDCIK---APSIVDRT--TTKYVNRLV----QRVDAVYRH--LRQR 706
            ..:.  .|...:|   |...:.||  ..||...|:    :|...||.|  ||::
 Worm   386 DLQMWNWGKTWLKEIVAMGPMSRTDYPAKYQKPLIDAVKRRTKYVYEHYSLREQ 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9395NP_001162973.2 Glyco_transf_92 407..708 CDD:279961 68/314 (22%)
C08B6.3NP_505599.2 Glyco_transf_92 174..419 CDD:366762 61/292 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4723
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.