DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9395 and F55C10.4

DIOPT Version :9

Sequence 1:NP_001162973.2 Gene:CG9395 / 34742 FlyBaseID:FBgn0032506 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_505887.1 Gene:F55C10.4 / 179573 WormBaseID:WBGene00010108 Length:517 Species:Caenorhabditis elegans


Alignment Length:322 Identity:62/322 - (19%)
Similarity:122/322 - (37%) Gaps:84/322 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   448 PHASCV-----LENYQKGLVPGNLT----AH-DLEALTPAEAANNATPRVLRTQYQR-PTVSILP 501
            |...||     .|.:|..||..:::    || .|..::..|:..|     |.::|:: ..|||.|
 Worm   157 PVIFCVSPQFAAEQWQTFLVQLHVSKRYGAHLQLYIVSMVESYFN-----LISEYEKMGLVSIEP 216

  Fly   502 W-----------------NLRMRSQKEIRTEGLFAALNDCLYRTMYRYKYLALVDLDEFIVPRYS 549
            |                 |:.:|:|....|        |||.:......::..:|:|:.::|..:
 Worm   217 WLTIKFSSTDGPYLEPNRNVELRNQAGAHT--------DCLLKYKESASFIGSLDMDDILIPNNA 273

  Fly   550 DTLNELIGSLNQRFRNRNTGAYSFQNAFYYLQFADDSLASSGIEGGNDQLARVRANLVTQRKTRR 614
            :       |..:.|.....|: .|.:|.:|.::...::..|.:.  :..|:.:..|  .:|.:  
 Worm   274 N-------SYYEEFEREYAGS-QFISALHYDKYDYKTIKVSELR--SQSLSAIVKN--AERLS-- 324

  Fly   615 RYKLHPQKQRSKYICKPEAVVEAGNHFVWEFAPGKGSLNVPPKE-AILQHYRVCEFGGNDCIKAP 678
                  .|...|...:||......:|  |..|..|..:.:...| .||:..:.....|...:|..
 Worm   325 ------TKDTGKSFVRPERFNSTWSH--WSRAAQKKPIYLDGYEKPILRELKTISNNGMFHLKNM 381

  Fly   679 SI----------VDRTTTKYVNRLVQR-----VDAVYRHLRQRCDLPALPPLLKTKENPQEK 725
            .:          :....|..|.:|::|     :||   .:::...:|::..|..:.  |:|:
 Worm   382 YLTEFNDLGIGQIPLNPTDNVTQLIEREHLAEIDA---DMKRMLSMPSISKLADSL--PKEE 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9395NP_001162973.2 Glyco_transf_92 407..708 CDD:279961 58/303 (19%)
F55C10.4NP_505887.1 Glyco_transf_92 156..422 CDD:279961 58/302 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.