DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9395 and K08D9.6

DIOPT Version :9

Sequence 1:NP_001162973.2 Gene:CG9395 / 34742 FlyBaseID:FBgn0032506 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_503885.2 Gene:K08D9.6 / 178760 WormBaseID:WBGene00019527 Length:530 Species:Caenorhabditis elegans


Alignment Length:262 Identity:47/262 - (17%)
Similarity:80/262 - (30%) Gaps:85/262 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   404 PDRIAVCVKPLHFNYDQALYLMEYLEFYALLGVSHFTFYNHTLGPHASCVLENYQKGLVPGNLTA 468
            |..:.:|:.|........:::|:.          |..   |..|.|    |..|...:|      
 Worm   185 PKPVIICISPQFVAEQWQIFMMQV----------HVA---HRFGGH----LHIYLTSIV------ 226

  Fly   469 HDLEALTPAEAANNATPRVLRTQYQRPTVSILPWNLRMR----------SQKEIRTEGLFAALND 523
                     |:..|     |..:|::.....|.:.|||:          ..:.:.......|..|
 Worm   227 ---------ESFFN-----LMREYEKRKYLTLDFWLRMKFTDTKTPFFEPNRHVEWRNQAGAQID 277

  Fly   524 CLYRTMYRYKYLALVDLDEFIVPR-YSDTLNELIG------SLNQRFRNRNTGAYSFQNAFYYLQ 581
            ||.:.....:::|..|:|:.:.|: |...|.|...      :.|..|..|....:....:|....
 Worm   278 CLLQYKEAAEFIAFFDMDDILFPKTYPTYLQEFRAEWEVDPTSNSIFYGRREHEFVKAKSFKTFN 342

  Fly   582 FAD--DSLASSGIEGGNDQLARVRANLVTQRKTRRRYKLHPQKQRSKYICKPEAVVEAGNHFVWE 644
            |.:  .:|.||      |.:                       :|.|.:.|||.......|:.|.
 Worm   343 FKEIVSTLESS------DTV-----------------------KRGKVVVKPERYNSTWIHYSWH 378

  Fly   645 FA 646
            .|
 Worm   379 DA 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9395NP_001162973.2 Glyco_transf_92 407..708 CDD:279961 46/259 (18%)
K08D9.6NP_503885.2 Glyco_transf_92 186..435 CDD:366762 46/261 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.