DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9395 and R05A10.6

DIOPT Version :9

Sequence 1:NP_001162973.2 Gene:CG9395 / 34742 FlyBaseID:FBgn0032506 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_502716.2 Gene:R05A10.6 / 178370 WormBaseID:WBGene00011023 Length:460 Species:Caenorhabditis elegans


Alignment Length:358 Identity:70/358 - (19%)
Similarity:127/358 - (35%) Gaps:112/358 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   406 RIAVCVKPLHFNYDQALYLMEYLEFYALLGVSHFTFYNHTLGPHASCVLENYQKGLVPGNLTAHD 470
            :::||:.|.:.|....|.:::::|...|.|.:.|.||...:..:...:|..|        :...|
 Worm   174 QLSVCMAPTYGNGSHWLPIVDFVEHNKLEGATFFFFYAGQIRKYDEKILNEY--------VRTGD 230

  Fly   471 LEALTPAEAANNATPRVLRTQYQRPTVSILPWNLRMRSQKEIRTEGLFAALNDCLYRTMYRYKYL 535
            :|.:.            |:.:|||..:|   |.              |..:.||..|:.|..|:.
 Worm   231 MELVK------------LQDKYQRVFIS---WQ--------------FLEVQDCHLRSKYFSKWT 266

  Fly   536 ALVDLDEFIV---PRYSDTLNEL----IGSLN-------------QRFRNRNTGAYSFQNAFYYL 580
            |::||||.:.   .|..|.|..:    ||.|:             .:|.||.    ..:....:.
 Worm   267 AVIDLDERMTTFGQRMIDLLRSIQDPSIGVLDVPHVHVIQNDDFPAKFENRT----QLEKELIFK 327

  Fly   581 QFADDSLASSGIEGGNDQLARVRANLVTQRKTRRRYKLHPQKQRSKYICKPEAVVEAGNHFVWEF 645
            ::  :...|:.|.|                              ||:|.:|:.:.....|.:...
 Worm   328 KY--NKTTSNQITG------------------------------SKFIIRPDKIGVMLIHEIVGM 360

  Fly   646 APGKGSLNVPPKEAILQHYRVC--------------EFGGNDCIKAPSIVDRTTTKYVNRLVQRV 696
            .||.....:...:|:|:|||..              :||.....|:..:.::.:......:||||
 Worm   361 WPGIKLQKLDKAQAVLRHYRSTKNRMYQPNWNEIPDKFGVMPIFKSVPLPEQFSKDLEEAVVQRV 425

  Fly   697 DAVYRHLRQRCDLPALPPLLKTK---ENPQEKP 726
            ..||..:...|.  ::|..|...   .:|.::|
 Worm   426 LRVYDSVPVNCS--SIPKQLANSLKYPDPCKEP 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9395NP_001162973.2 Glyco_transf_92 407..708 CDD:279961 65/334 (19%)
R05A10.6NP_502716.2 Glyco_transf_92 173..417 CDD:366762 59/315 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4723
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.