DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9395 and LOC100536206

DIOPT Version :9

Sequence 1:NP_001162973.2 Gene:CG9395 / 34742 FlyBaseID:FBgn0032506 Length:840 Species:Drosophila melanogaster
Sequence 2:XP_009302352.1 Gene:LOC100536206 / 100536206 -ID:- Length:260 Species:Danio rerio


Alignment Length:304 Identity:66/304 - (21%)
Similarity:113/304 - (37%) Gaps:79/304 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 NYDQALYLMEYLEFYALLGVSHFTFYNHTLGPHASCVLENYQ-KGLV-----PGNLTAHDLEALT 475
            ||:..|... .:|.|.||||.|...|..:.|.....:|:.|: :|::     |.|      :.|.
Zfish     3 NYNNVLQFAXTMEMYKLLGVQHVVLYKTSCGKDLEKLLKYYESEGILEIVSWPIN------KFLN 61

  Fly   476 PAEAANNATPRVLRTQYQRPTVSILPWNLRMRSQKEIRTEGLFAALNDCLYRTMYRYKYLALVDL 540
            |:..                      ||.: ..:.::...|....||:|:||.||:.||:.|.|:
Zfish    62 PSSG----------------------WNFQ-EHKGDLHYYGQLVTLNECIYRHMYQSKYVLLNDI 103

  Fly   541 DEFIVPRYSDTLNELIGSLNQRFRNRNTGAYSF---QNAFYYLQFADDSLAS----SGIEGGN-- 596
            ||.|:|.....|..|:    :..::.:.||..|   .:.|...||.:.....    :.|.|.|  
Zfish   104 DEIIMPYKHTNLQALM----EYLQSTHPGASVFHVKSHLFPTTQFEESGKFKRKEWNNIPGVNIM 164

  Fly   597 DQLARV--------RANLVTQRKTRRRYKLHPQKQRSKYICKPEAVVEAGNHFVWEFAPGKGSLN 653
            :.:.|.        .|.::...:...:..:|...:.|.|.|           ||        :.:
Zfish   165 EHIYRAPEPKNVYNPAKMIINPRKVEQTSVHSSLKHSGYYC-----------FV--------AFD 210

  Fly   654 VPPKEAILQHYRVCEFGGNDCIKAPSIVDRTTTKYVNRLVQRVD 697
            |    :.:.|.|.....|.:..|...:||:....:.:.|:..||
Zfish   211 V----SRMIHVREPFQNGANLTKEQLLVDKRVWDFKHELIPNVD 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9395NP_001162973.2 Glyco_transf_92 407..708 CDD:279961 66/304 (22%)
LOC100536206XP_009302352.1 Glyco_tranf_GTA_type 1..220 CDD:325014 59/272 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.