DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31729 and stoml3

DIOPT Version :9

Sequence 1:NP_609634.1 Gene:CG31729 / 34736 FlyBaseID:FBgn0051729 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_989344.1 Gene:stoml3 / 394970 XenbaseID:XB-GENE-1015871 Length:283 Species:Xenopus tropicalis


Alignment Length:191 Identity:34/191 - (17%)
Similarity:68/191 - (35%) Gaps:73/191 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 FLLMALSQFIPDIRIGYPYTYWGPLGFVLMVTICREAVDDLRRHQRDHEVNSQKYKRLSSTNISG 324
            ::::.||.|:  ..|.:|.:.|          .|.:.:              |:|:|        
 Frog    32 WIILILSAFM--AAITFPLSIW----------FCVKII--------------QEYER-------- 62

  Fly   325 YEMVPSSKLKVGDVIIVEKNERVPADLILLRTSDRSGSVFVRTDQLDGETDWKPRL---AVPYTQ 386
                 :...::|.  |:....:.|..:.:|..:|    .|::.|.         |:   |:|..:
 Frog    63 -----AVVFRLGR--IISGKAKGPGVMFVLPCTD----TFIKVDL---------RVISFAIPPQE 107

  Fly   387 KLSRDSELHSIDASFYVEKPQ--------NDIHSFIATFCMADGSEDTGLSVENTLWANTV 439
            .|::||...::|...|.....        |::|  |||..:|.      .::.|.|...|:
 Frog   108 ILTKDSVTTTVDGVVYYNIQSAIKAVANVNNVH--IATQQLAQ------TTLRNILGTQTL 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31729NP_609634.1 PhoLip_ATPase_N 227..279 CDD:292826 5/18 (28%)
ATPase-Plipid 228..1252 CDD:273734 34/191 (18%)
E1-E2_ATPase 323..525 CDD:278548 24/128 (19%)
Cation_ATPase <704..783 CDD:289987
HAD_like <975..1019 CDD:304363
PhoLip_ATPase_C 1021..1249 CDD:292829
stoml3NP_989344.1 SPFH_like 73..274 CDD:418525 22/109 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165164432
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.