DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uvrag and VPS38

DIOPT Version :9

Sequence 1:NP_609632.1 Gene:Uvrag / 34735 FlyBaseID:FBgn0032499 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_013464.3 Gene:VPS38 / 851074 SGDID:S000004352 Length:439 Species:Saccharomyces cerevisiae


Alignment Length:315 Identity:56/315 - (17%)
Similarity:115/315 - (36%) Gaps:95/315 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 RLKPRTTSLSGDYSAHQYHSMGRALSVLLAEQQQIAPLTLYNAQQLTRRIEALSSQQRLLKAERE 353
            ::||    |.|..|:|:     |.:|     |.:|.....|:         :|....:||:...:
Yeast   155 KIKP----LKGLVSSHK-----RNIS-----QVKIKFSLAYS---------SLLKLNKLLEYSSQ 196

  Fly   354 TFRQRNERTRQLLKEMREQREAQQWELHSQRHRLEKERLELRTLAPQHLEQRDQKRQIER----- 413
            ...:.||.:.::..:....:....|.:.:.:..:|       ||..:.|:::..|:.||.     
Yeast   197 VHEEINEISSKIEDDFLSLKNQNHWYMRTVQKSIE-------TLEKEVLQRKKSKKNIEMAQLES 254

  Fly   414 --QVERRMSTLVLELQEIYNIQNVGG------------------RQFSICGIAFPHMEQYTSE-- 456
              .:....:.|.|..|:.....:.|.                  :.:.:.|| |...:.:.|:  
Yeast   255 NDTINHSKTELSLMSQDESINDDYGSIYSRFVQIKDRLDQLRFKKLYQLIGI-FHSTDLFNSDRG 318

  Fly   457 ----SRQAANAQLLD--NVSPL-----------------AVSAALGYVAHLVQMLAI-IMDRPLR 497
                .:.::...:::  .:.||                 .|::.|||....:.:.|| |...||.
Yeast   319 YIYFEKPSSVNDVINRLKLKPLNIEILLRQAGESTKHREYVNSQLGYYLLFLHLTAIQIFKAPLP 383

  Fly   498 NRILYEPSKARIVDDIKELTYTTREFPLY-TRSILPSQQTKY--AIYLLRQNVSQ 549
            .|::|..|.: ::|.         ::||| |..::...|.|.  ||:....::.|
Yeast   384 YRLMYYGSTS-VIDS---------QYPLYFTDQMISKHQAKLIKAIHYFNADILQ 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UvragNP_609632.1 Atg14 329..574 CDD:287195 46/275 (17%)
VPS38NP_013464.3 VPS38 1..436 CDD:407545 56/315 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15157
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.