DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uvrag and AT2G32760

DIOPT Version :9

Sequence 1:NP_609632.1 Gene:Uvrag / 34735 FlyBaseID:FBgn0032499 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_850197.1 Gene:AT2G32760 / 817836 AraportID:AT2G32760 Length:352 Species:Arabidopsis thaliana


Alignment Length:355 Identity:81/355 - (22%)
Similarity:144/355 - (40%) Gaps:110/355 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 DYSAHQYHSMGRALSVLLAEQQQIAPLTLYNAQQLTRRIEALSSQQRLLKAERETFRQRNERTRQ 364
            |:...:..|:..|:. |..|::||          |..::|:      |::...|:.|:.||    
plant    30 DHELTRLWSLSSAMK-LATERKQI----------LQPKLES------LIQVSTESLRRTNE---- 73

  Fly   365 LLKEMREQREAQQ---------WELHSQRHRLEKERL--ELRTL---------APQHLEQRDQKR 409
             |:|||::.||::         .::..|..:.::|.|  |:|:|         |...|::.:.:.
plant    74 -LEEMRQRLEARKLLVDKTSVACKVTEQDVKKKEENLSTEVRSLLVGGTTLSIAKSKLQESNCQL 137

  Fly   410 Q----------IERQVERRMSTLVLELQEIYNIQ------------------NVGGRQFS----- 441
            :          :..::.:|...:|.::..||.::                  .:|.:..|     
plant   138 EGESGYAHLKIVTNKLRKRQQFMVSQVSFIYPLKIEAGPSQDQELESFPGGSRLGTKPLSQGSVR 202

  Fly   442 ICGIAFPHMEQYTSESRQAANAQLLDNVSPLAVSAALGYVAHLVQMLAIIMDRPLRNRILYEPSK 506
            |.|:.| .|..:|..|      ...|.......:.|||||||.|.::|..:..|:|..:....||
plant   203 ILGLPF-SMAPFTKMS------FFTDKKEVQKSATALGYVAHAVSLIAPYLRVPIRYPLCLGGSK 260

  Fly   507 ARIVD----------DIKELTYTTR-----EFPLYTRSILPSQQT---KYAIYLLRQNVSQLCFD 553
            ..|.|          |:..:|..::     ||||:    |..|.|   .||::||.:|:.|| .:
plant   261 TYIRDYAPYIEPSPSDMSPITTLSQNINFVEFPLF----LDGQDTTRAAYAVFLLNKNIEQL-LN 320

  Fly   554 ITGQCDL--RNTFGNLLELFSTLR---YIE 578
            ..|:..|  |....||.||...::   ||:
plant   321 FVGENSLGPRQVLANLKELIRIIQSPDYID 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UvragNP_609632.1 Atg14 329..574 CDD:287195 72/317 (23%)
AT2G32760NP_850197.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2896
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.