DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k05911 and CG11836

DIOPT Version :9

Sequence 1:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:262 Identity:103/262 - (39%)
Similarity:162/262 - (61%) Gaps:13/262 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 TSSEGLPLQCGNKNPVTPDQERIVGGINASPHEFPWIAVLFKSGKQFCGGSLITNSHILTAAHCV 442
            :|.:.....||..|    ::.|||||.....:::||:|.:...||..|||||:|..::|:|||||
  Fly    79 SSLKNCDCDCGFSN----EEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCV 139

  Fly   443 ARMTSWDVAALTAHLGDYNIGTDFEVQHVSRRIKRLVRHKGFEFSTLHNDVAILTLSEPVPFTRE 507
            .::....:..:   .||::.....|.|.:.|.:..:::||.|:..|.:||:|:|.|.:|:.|::.
  Fly   140 KKLRKSKIRVI---FGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKI 201

  Fly   508 IQPICLPTSPSQQSRSYSGQVATVAGWGSLRENGPQPSILQKVDIPIWTNAECARKYGRAAPGGI 572
            |:|||||    :.:...:|::.||.|||...|.|..|||:.:|.:||.:..||..:  |.....|
  Fly   202 IKPICLP----RYNYDPAGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQ--RYKSTRI 260

  Fly   573 IESMICAGQAAKDSCSGDSGGPMVINDGGRYTQVGIVSWGIGCGKGQYPGVYTRVTSLLPWIYKN 637
            ..||:|||:.:.|||.||||||:::::|.:|..|||||||:|||:..|||||:||:..:|||..|
  Fly   261 TSSMLCAGRPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSN 325

  Fly   638 IK 639
            ::
  Fly   326 LE 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 96/234 (41%)
Tryp_SPc 400..637 CDD:238113 97/236 (41%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 97/236 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 180 1.000 Domainoid score I3447
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
54.910

Return to query results.
Submit another query.