DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k05911 and ea

DIOPT Version :9

Sequence 1:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:333 Identity:104/333 - (31%)
Similarity:157/333 - (47%) Gaps:66/333 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 STKRTTPRPTSPARPTTTRRPTYPSYPSPVTTTTTTRRPVSGTSSEGLPLQCGN--KNPVTPDQE 398
            |:..|||    |.:|..|.....|                       ||.||||  .|       
  Fly    96 SSSETTP----PPKPNVTSNSLLP-----------------------LPGQCGNILSN------- 126

  Fly   399 RIVGGINASPHEFPWIAVL--FKS-GKQ--FCGGSLITNSHILTAAHCV---ARMTSWDVAALTA 455
            ||.||:.....||||:|::  .|| ||:  .||||||:..:::||:|||   |..|.|.::.:..
  Fly   127 RIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGKALPTDWRLSGVRL 191

  Fly   456 HLGDYNIGTDFEVQ----------HVSRRIKRLVRHKGFEFSTLH--NDVAILTLSEPVPFTREI 508
            ...|.|...|.||.          |:...::|.:.|..:..::.:  ||:|:|.|::.|.:|..:
  Fly   192 GEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIALLRLAQQVEYTDFV 256

  Fly   509 QPICLPTSPSQQSRSYSGQVATVAGWGSLRENGPQPSILQKVDIPIWTNAECARKYGRAAPGGII 573
            :|||||...:.:|.::.|....|||||. .|.....::..|..:..:...||...|  ::...::
  Fly   257 RPICLPLDVNLRSATFDGITMDVAGWGK-TEQLSASNLKLKAAVEGFRMDECQNVY--SSQDILL 318

  Fly   574 E-SMICA-GQAAKDSCSGDSGGPMVINDGGR----YTQVGIVSWG-IGCGKGQYPGVYTRVTSLL 631
            | :.:|| |:...|||.||||||::..|..:    |...|:||:| ..||...:|||||.|...:
  Fly   319 EDTQMCAGGKEGVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYV 383

  Fly   632 PWIYKNIK 639
            .||...|:
  Fly   384 DWIQNTIE 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 86/261 (33%)
Tryp_SPc 400..637 CDD:238113 87/263 (33%)
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 86/261 (33%)
Tryp_SPc 128..389 CDD:238113 87/263 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.