DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k05911 and Ser6

DIOPT Version :10

Sequence 1:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:70 Identity:13/70 - (18%)
Similarity:20/70 - (28%) Gaps:17/70 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 WIQCMHDHQQSTSFFSTVENIFGLMCLAQVSTATLS-------------ICDAMLLVLLTD---- 289
            |.....|.....|.|.......|...|....|.:.|             |.::.|:::..|    
  Fly    50 WWYAKRDEAVKESGFPEASGTIGYTMLYDRKTCSASTECLFTSTGDKSRISNSTLVIVTADKKVA 114

  Fly   290 WYPTY 294
            .:|.|
  Fly   115 EFPAY 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
PTZ00449 <198..>376 CDD:185628 13/70 (19%)
Tryp_SPc 400..637 CDD:238113
Ser6NP_523426.1 Tryp_SPc 32..256 CDD:238113 13/70 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.